Mustela lutreola (European mink): 131818548 Help Entry 131818548         CDS       T09578                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04061   Viral protein interaction with cytokine and cytokine receptor mlk04062   Chemokine signaling pathway mlk04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131818548 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     131818548 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131818548 (CCL22)    04062 Chemokine signaling pathway     131818548 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131818548 (CCL22) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Chemokines    131818548 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  131818548 NCBI-ProteinID:  XP_059009120 LinkDB All DBs Position 16:complement(26657522..26663769) Genome browser AA seq 93 aa AA seqDB search MASLNTPLLAALVFLALILQTTEAGPYGTNVEDSVCCREYFRHPLPLRMIRFFYWTSDSC RRPGVVFLTVKDREICADPRMPWVKKILQKLSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaacactccactcctggctgcccttgtctttcttgctctgatacttcaa acaactgaggcaggtccttatggcaccaacgtggaagacagcgtctgctgccgggagtac ttccgtcaccctctgcctctgcgcatgatcaggtttttctactggacttcagactcgtgc cggaggcctggcgtggtcttcctaactgtcaaggaccgggagatctgtgctgaccccaga atgccctgggtgaaaaagattctccagaaactgagcgcatga

DBGET integrated database retrieval system