Mustela lutreola (European mink): 131819776 Help Entry 131819776         CDS       T09578                                  Symbol ELOB Name (RefSeq) elongin-B isoform X1   KO K03873   elongin-B Organism mlk  Mustela lutreola (European mink) Pathway mlk04066   HIF-1 signaling pathway mlk04120   Ubiquitin mediated proteolysis mlk05170   Human immunodeficiency virus 1 infection mlk05200   Pathways in cancer mlk05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mlk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     131819776 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     131819776 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131819776 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     131819776 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     131819776 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mlk04121]     131819776 (ELOB)    03400 DNA repair and recombination proteins [BR:mlk03400]     131819776 (ELOB) Ubiquitin system [BR:mlk04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      131819776 (ELOB)    Cul5 complex      131819776 (ELOB) DNA repair and recombination proteins [BR:mlk03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      131819776 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  131819776 NCBI-ProteinID:  XP_059011070 LinkDB All DBs Position 17:complement(21525539..21531331) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADEAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagtaccgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccacccgac gagcagcggctgtacaaggatgaccagcttctggatgacggcaagacactgggagagtgc ggctttaccagtcagacggcccggccgcaggccccagccactgtagggctggccttccga gcggatgaagcttttgaggctctgcgcatcgagcccttctccagcccacctgagctgccc gatgtgatgaagccacaggactcaggaagcagcgccaatgaacaagcggtgcagtga

DBGET integrated database retrieval system