KEGG   Mustela lutreola (European mink): 131821701
Entry
131821701         CDS       T09578                                 
Symbol
NDUFA1
Name
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
mlk  Mustela lutreola (European mink)
Pathway
mlk00190  Oxidative phosphorylation
mlk01100  Metabolic pathways
mlk04714  Thermogenesis
mlk04723  Retrograde endocannabinoid signaling
mlk04932  Non-alcoholic fatty liver disease
mlk05010  Alzheimer disease
mlk05012  Parkinson disease
mlk05014  Amyotrophic lateral sclerosis
mlk05016  Huntington disease
mlk05020  Prion disease
mlk05022  Pathways of neurodegeneration - multiple diseases
mlk05208  Chemical carcinogenesis - reactive oxygen species
mlk05415  Diabetic cardiomyopathy
Module
mlk_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:mlk00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    131821701 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    131821701 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    131821701 (NDUFA1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    131821701 (NDUFA1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    131821701 (NDUFA1)
   05012 Parkinson disease
    131821701 (NDUFA1)
   05014 Amyotrophic lateral sclerosis
    131821701 (NDUFA1)
   05016 Huntington disease
    131821701 (NDUFA1)
   05020 Prion disease
    131821701 (NDUFA1)
   05022 Pathways of neurodegeneration - multiple diseases
    131821701 (NDUFA1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    131821701 (NDUFA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    131821701 (NDUFA1)
SSDB
Motif
Pfam: MWFE
Other DBs
NCBI-GeneID: 131821701
NCBI-ProteinID: XP_059013947
LinkDB
Position
X:102931385..102935267
AA seq 70 aa
MWFEILPGIGVMAVCLVIPGIATAHIHRFTNGGKEKRVAYYPYQWSLMQRDRRISGVDRY
YVSKGLENID
NT seq 213 nt   +upstreamnt  +downstreamnt
atgtggttcgagatcctgcccgggatcggcgtcatggccgtgtgcttggtcatccccggc
atagccacggcgcacatccacaggttcaccaacgggggcaaggaaaaaagggttgcctat
tatccatatcagtggagtttgatgcaaagagataggcgcatctctggagttgatcgttac
tatgtgtcaaagggtttggagaatatcgattaa

DBGET integrated database retrieval system