Mustela lutreola (European mink): 131821936 Help Entry 131821936         CDS       T09578                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism mlk  Mustela lutreola (European mink) Pathway mlk04613   Neutrophil extracellular trap formation mlk05034   Alcoholism mlk05202   Transcriptional misregulation in cancer mlk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131821936  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     131821936   09163 Immune disease    05322 Systemic lupus erythematosus     131821936   09165 Substance dependence    05034 Alcoholism     131821936  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131821936   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131821936 Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131821936 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131821936 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa YebU_pre-PUA_dom Motif Other DBs NCBI-GeneID:  131821936 NCBI-ProteinID:  XP_059014291 LinkDB All DBs Position X:103354168..103354595 Genome browser AA seq 136 aa AA seqDB search MAPTKQTAHKSTGGKAPRKQLATKAARKSAPSTGGVKKLHRYRPGTVAFREIRRYQKSTE LMICKFPFQRLVQEIAQDFKTDLRFQSAAIAALQEASEAYLVGLFEDTNLCALHAKRATI MPKDIQLACRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcctacaaagcagactgcccacaaatcgaccgggggtaaagctccaaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctaccggaggggtgaagaaacttcat cgttacaggcctggtactgtggcattccgtgaaattagacgatatcagaagtccactgaa cttatgatttgcaaatttcctttccagcgtctggtgcaagaaattgctcaggacttcaaa acagacttgcgcttccagagtgcagctattgctgctttgcaggaggcaagcgaggcctat ctggtgggcctctttgaagacaccaacctgtgtgctctccatgccaaacgtgccacaatt atgccaaaagacatccagctagcgtgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system