Mustela lutreola (European mink): 131824174 Help Entry 131824174         CDS       T09578                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism mlk  Mustela lutreola (European mink) Pathway mlk04382   Cornified envelope formation mlk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     131824174  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131824174  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131824174 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of microglial cells    131824174 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 TFIIE_beta STAT_linker Motif Other DBs NCBI-GeneID:  131824174 NCBI-ProteinID:  XP_059017553 LinkDB All DBs Position 2:49661712..49662185 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLQVLMEKEFAGFLKNQKDPLTMDKIMKDLD QCRDVKVGFQSCFSLIAGLNIACNDYFVVHMKQKRKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccatctcaaatggaacatgccatggaaaccatgatgttcacatttcacaagtttgct ggggataaagggtacttaacaaaggaggatctgcaagtactcatggaaaaggagtttgca ggatttttgaaaaatcagaaagaccctctgaccatggacaaaataatgaaggacctcgac cagtgccgagatgtcaaagtgggcttccagagctgcttctcactaatcgcggggctcaac attgcatgcaatgactattttgtagtacacatgaagcagaagagaaagaagtag

DBGET integrated database retrieval system