Mustela lutreola (European mink): 131824215 Help Entry 131824215         CDS       T09578                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism mlk  Mustela lutreola (European mink) Pathway mlk04810   Regulation of actin cytoskeleton mlk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlk00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131824215 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131824215 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  131824215 NCBI-ProteinID:  XP_059017695 LinkDB All DBs Position 2:52172774..52184161 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcaagaggatccggtgcagcgggagattcaccaggactgggcgaaccgagaa tacattgaggtcatcaccagcagcatcaagaaaatcgcggactttctcaactcattcgat atgtcttgtcgttcaagacttgcaacactaaacgagaaattgacagcccttgaacggaga atagagtacattgaagcgcgggtgacaaaaggtgagaccctcacctag

DBGET integrated database retrieval system