Mustela lutreola (European mink): 131824928 Help Entry 131824928         CDS       T09578                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04620   Toll-like receptor signaling pathway mlk04622   RIG-I-like receptor signaling pathway mlk04625   C-type lectin receptor signaling pathway mlk04630   JAK-STAT signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04936   Alcoholic liver disease mlk04940   Type I diabetes mellitus mlk05133   Pertussis mlk05134   Legionellosis mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05143   African trypanosomiasis mlk05144   Malaria mlk05145   Toxoplasmosis mlk05146   Amoebiasis mlk05152   Tuberculosis mlk05162   Measles mlk05164   Influenza A mlk05168   Herpes simplex virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05200   Pathways in cancer mlk05321   Inflammatory bowel disease mlk05330   Allograft rejection mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     131824928 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131824928 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131824928 (IL12A)    04622 RIG-I-like receptor signaling pathway     131824928 (IL12A)    04625 C-type lectin receptor signaling pathway     131824928 (IL12A)    04658 Th1 and Th2 cell differentiation     131824928 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131824928 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     131824928 (IL12A)    05164 Influenza A     131824928 (IL12A)    05162 Measles     131824928 (IL12A)    05168 Herpes simplex virus 1 infection     131824928 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     131824928 (IL12A)    05134 Legionellosis     131824928 (IL12A)    05152 Tuberculosis     131824928 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     131824928 (IL12A)    05144 Malaria     131824928 (IL12A)    05145 Toxoplasmosis     131824928 (IL12A)    05140 Leishmaniasis     131824928 (IL12A)    05142 Chagas disease     131824928 (IL12A)    05143 African trypanosomiasis     131824928 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     131824928 (IL12A)    05330 Allograft rejection     131824928 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131824928 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     131824928 (IL12A)    04936 Alcoholic liver disease     131824928 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131824928 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131824928 (IL12A) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interleukins    131824928 (IL12A) Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Cytokines    131824928 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 Motif Other DBs NCBI-GeneID:  131824928 NCBI-ProteinID:  XP_059019634 LinkDB All DBs Position 2:complement(139674916..139682318) Genome browser AA seq 222 aa AA seqDB search MCPPRGLYLLTILVLLNHVDDLSLARSLPTASPSPGMFQCLSHSQNLLRAVSNTLQKAQQ TLELYSCTSEEIDHEDITKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKAS FMTTLCLSSIYEDLKMYQVEFKAMNAKLLMDPKRQIFLDQSMLTAIDDLLQALNFNSVTV PQTSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS NT seq 669 nt NT seq  +upstreamnt  +downstreamnt atgtgcccgccgcgcggcctctaccttctgaccatcttggtcctcctaaaccacgtggac gacctcagtttggccaggagcctccccacagcatccccaagcccaggaatgttccagtgc ctcagccactcccaaaacctgctgagagctgtcagcaacacgcttcagaaggcccaacaa accctagaactttactcctgcacttctgaagagattgatcatgaagatatcacaaaggat aaaaccagcaccgtggaggcctgcttaccattggaattaaccatgaatgagagttgcctg gcttccagagagatctctttgataactaatgggagttgcctggcctccagaaaggcctcc tttatgacgaccctgtgccttagcagtatctatgaggacttgaagatgtaccaggtggag ttcaaggccatgaacgcaaagcttttaatggatcctaagaggcagatctttctggatcaa agcatgctgacggctattgatgacttgttgcaggccctgaatttcaacagtgtgactgtg ccacagacatcttcccttgaagaaccagatttttataaaactaaaatcaagctctgcata cttcttcatgctttcagaattcgtgccgtgaccatcgatagaatgatgagctatctgaac tcttcctaa

DBGET integrated database retrieval system