Mustela lutreola (European mink): 131825004 Help Entry 131825004         CDS       T09578                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism mlk  Mustela lutreola (European mink) Pathway mlk04015   Rap1 signaling pathway mlk04810   Regulation of actin cytoskeleton mlk05014   Amyotrophic lateral sclerosis mlk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     131825004 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131825004 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131825004 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     131825004 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlk04131]     131825004 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlk04812]     131825004 (PFN2)    04147 Exosome [BR:mlk04147]     131825004 (PFN2) Membrane trafficking [BR:mlk04131]  Others   Actin-binding proteins    Others     131825004 (PFN2) Cytoskeleton proteins [BR:mlk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      131825004 (PFN2) Exosome [BR:mlk04147]  Exosomal proteins   Proteins found in most exosomes    131825004 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  131825004 NCBI-ProteinID:  XP_059019773 LinkDB All DBs Position 2:149016387..149024059 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system