Mustela lutreola (European mink): 131831363 Help Entry 131831363         CDS       T09578                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mlk  Mustela lutreola (European mink) Pathway mlk04015   Rap1 signaling pathway mlk04810   Regulation of actin cytoskeleton mlk05014   Amyotrophic lateral sclerosis mlk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     131831363 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131831363 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131831363 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     131831363 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlk04131]     131831363 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mlk04812]     131831363 (PFN3)    04147 Exosome [BR:mlk04147]     131831363 (PFN3) Membrane trafficking [BR:mlk04131]  Others   Actin-binding proteins    Others     131831363 (PFN3) Cytoskeleton proteins [BR:mlk04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      131831363 (PFN3) Exosome [BR:mlk04147]  Exosomal proteins   Proteins found in most exosomes    131831363 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  131831363 NCBI-ProteinID:  XP_059029447 LinkDB All DBs Position 5:complement(65646743..65647268) Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGHDRRTFL LSGLSVAGRRCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRKQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaagggctatatcagtgcggtgttgcgtgaccagcgcattgacgacgtg gccatcgtgggtcactcagacaatcgctgcgtgtgggcatcgcgccccggaggccttctg gctgccatatcgccgcaggaggtgggtgtgctcacagggcatgaccggcgcaccttcctg ctgtcgggcctcagcgtggcgggccgccgctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcgcgcaccaaggggttggatgggcgcgcggtctgcgtc ggccacaccccgcgcgtgctcctcgtgctcatgggcaggcgcggcgtgcacgggggcatc ctcaataagacggtgcatgaactgatcaagggtctgcgcaagcagggcacctag

DBGET integrated database retrieval system