Mustela lutreola (European mink): 131832021 Help Entry 131832021         CDS       T09578                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mlk  Mustela lutreola (European mink) Pathway mlk04060   Cytokine-cytokine receptor interaction mlk04630   JAK-STAT signaling pathway mlk04640   Hematopoietic cell lineage mlk04657   IL-17 signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04660   T cell receptor signaling pathway mlk04664   Fc epsilon RI signaling pathway mlk04672   Intestinal immune network for IgA production mlk05200   Pathways in cancer mlk05310   Asthma mlk05320   Autoimmune thyroid disease mlk05321   Inflammatory bowel disease mlk05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     131832021 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131832021 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     131832021 (IL5)    04660 T cell receptor signaling pathway     131832021 (IL5)    04658 Th1 and Th2 cell differentiation     131832021 (IL5)    04657 IL-17 signaling pathway     131832021 (IL5)    04664 Fc epsilon RI signaling pathway     131832021 (IL5)    04672 Intestinal immune network for IgA production     131832021 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131832021 (IL5)   09163 Immune disease    05310 Asthma     131832021 (IL5)    05320 Autoimmune thyroid disease     131832021 (IL5)    05321 Inflammatory bowel disease     131832021 (IL5)    05330 Allograft rejection     131832021 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131832021 (IL5)    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131832021 (IL5) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interleukins    131832021 (IL5) Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Cytokines    131832021 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  131832021 NCBI-ProteinID:  XP_059030523 LinkDB All DBs Position 5:complement(71074868..71076869) Genome browser AA seq 134 aa AA seqDB search MRLLLHLSLLALGAAYVSVTPVEDPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPENKNH QLCIEEVFQGIDILKNRTAQAAAVDKLFQNLSFIKAHIDSQKKKCGGERWRVKKFLDYLQ VFLGVINTEWTTES NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgagactgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgtcact cctgtagaagatcccatgaacagattggtggcagagaccttgacactgctctccactcat cgaactctgctgataggtgacgggaacctgatgattcctactcctgaaaataaaaatcac caactgtgcatcgaagaagtctttcagggtatagacatattaaagaaccgaactgcacaa gcagcggctgtggataaactattccaaaatttgtctttcataaaagcacatatagacagc caaaaaaaaaaatgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa gtgtttcttggtgtcataaacactgagtggacaacagaaagttga

DBGET integrated database retrieval system