Mustela lutreola (European mink): 131833008 Help Entry 131833008         CDS       T09578                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism mlk  Mustela lutreola (European mink) Pathway mlk04613   Neutrophil extracellular trap formation mlk05034   Alcoholism mlk05202   Transcriptional misregulation in cancer mlk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131833008  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     131833008   09163 Immune disease    05322 Systemic lupus erythematosus     131833008   09165 Substance dependence    05034 Alcoholism     131833008  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131833008   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131833008 Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131833008 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131833008 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  131833008 NCBI-ProteinID:  XP_059032238 LinkDB All DBs Position 6:155882035..155882534 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcgcgcaagtcgaccggcggcaaggccccgcgcaagcag ctggccaccaaggcggctcgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggcgagagggcgtaa

DBGET integrated database retrieval system