Mustela lutreola (European mink): 131833295 Help Entry 131833295         CDS       T09578                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism mlk  Mustela lutreola (European mink) Pathway mlk04613   Neutrophil extracellular trap formation mlk05034   Alcoholism mlk05203   Viral carcinogenesis mlk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131833295  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     131833295   09163 Immune disease    05322 Systemic lupus erythematosus     131833295   09165 Substance dependence    05034 Alcoholism     131833295  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131833295   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlk04147]     131833295 Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131833295 Exosome [BR:mlk04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131833295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  131833295 NCBI-ProteinID:  XP_059032397 LinkDB All DBs Position 6:complement(155636089..155636529) Genome browser AA seq 127 aa AA seqDB search MPELTSKGTTISKKGFKKAVTKTQRKEGKKRKRCRKESYSIYIYKVLKQVHPDTGISSKA MGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgccagagctgacttcgaagggcactaccatttccaagaaaggtttcaagaaagcagta acaaaaactcagagaaaagaagggaaaaagcgtaagagatgtcgcaaagagagctattcc atttacatctataaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggcc atgggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcc cgcctggcgcactacaacaagcgctcgaccatcacgtccagggagatccagacggccgtg cgcctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system