Mustela lutreola (European mink): 131833418 Help Entry 131833418         CDS       T09578                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism mlk  Mustela lutreola (European mink) Pathway mlk04814   Motor proteins mlk05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mlk00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     131833418 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     131833418 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mlk03037]     131833418 (DYNLT1)    04812 Cytoskeleton proteins [BR:mlk04812]     131833418 (DYNLT1) Cilium and associated proteins [BR:mlk03037]  Motile cilia and associated proteins   Dynein arm    131833418 (DYNLT1) Cytoskeleton proteins [BR:mlk04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      131833418 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 P22_AR_C Motif Other DBs NCBI-GeneID:  131833418 NCBI-ProteinID:  XP_059032632 LinkDB All DBs Position 6:8880451..8888115 Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggctgcggaggagactgcttttgtcgtcgatgaagtgagcaacatt gtaaaagaggctatagagagcgcgatcggtggcaatgcctaccagcacagcaaagtgaat cagtggaccacaaacgtagtagaacaaactttaagccaactcaccaagctgggaaagcca tttaagtacatcgtgacctgtgtgattatgcagaagaacggagcggggctgcacacggcg agttcctgcttctgggacagctctacggacggcagctgcaccgtgcggtgggagaacaag accatgtactgcatcgtcagcgccttcgggctgtccatctga

DBGET integrated database retrieval system