Mustela lutreola (European mink): 131833963 Help Entry 131833963         CDS       T09578                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism mlk  Mustela lutreola (European mink) Pathway mlk00190   Oxidative phosphorylation mlk01100   Metabolic pathways mlk01524   Platinum drug resistance mlk04115   p53 signaling pathway mlk04210   Apoptosis mlk04215   Apoptosis - multiple species mlk04932   Non-alcoholic fatty liver disease mlk05010   Alzheimer disease mlk05012   Parkinson disease mlk05014   Amyotrophic lateral sclerosis mlk05016   Huntington disease mlk05017   Spinocerebellar ataxia mlk05020   Prion disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05132   Salmonella infection mlk05134   Legionellosis mlk05145   Toxoplasmosis mlk05152   Tuberculosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05200   Pathways in cancer mlk05210   Colorectal cancer mlk05222   Small cell lung cancer mlk05416   Viral myocarditis mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     131833963  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     131833963    04215 Apoptosis - multiple species     131833963    04115 p53 signaling pathway     131833963  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131833963   09162 Cancer: specific types    05210 Colorectal cancer     131833963    05222 Small cell lung cancer     131833963   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     131833963    05161 Hepatitis B     131833963    05160 Hepatitis C     131833963    05164 Influenza A     131833963    05162 Measles     131833963    05168 Herpes simplex virus 1 infection     131833963    05163 Human cytomegalovirus infection     131833963    05167 Kaposi sarcoma-associated herpesvirus infection     131833963    05169 Epstein-Barr virus infection     131833963   09171 Infectious disease: bacterial    05132 Salmonella infection     131833963    05134 Legionellosis     131833963    05152 Tuberculosis     131833963   09174 Infectious disease: parasitic    05145 Toxoplasmosis     131833963   09164 Neurodegenerative disease    05010 Alzheimer disease     131833963    05012 Parkinson disease     131833963    05014 Amyotrophic lateral sclerosis     131833963    05016 Huntington disease     131833963    05017 Spinocerebellar ataxia     131833963    05020 Prion disease     131833963    05022 Pathways of neurodegeneration - multiple diseases     131833963   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131833963    05416 Viral myocarditis     131833963   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     131833963   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     131833963 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrom_C550 Cytochrome_CBB3 Motif Other DBs NCBI-GeneID:  131833963 NCBI-ProteinID:  XP_059033920 LinkDB All DBs Position 1:162305014..162306289 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKSAQCHTVEKGGKHKTGPNLHGLFGRKTGQALGFSYTDANKNKGITW GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaagtctgcccagtgccatacc gtggaaaagggaggcaagcacaagactgggccaaatctccatggtttatttggccgaaag accggtcaggcccttggattttcttacacggatgccaacaagaataaaggcatcacctgg ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctgggacaaaa atgatcttcgctggcattaagaagacgggggaaagagcagacttgatagcttatctcaaa aaagctactaaggagtaa

DBGET integrated database retrieval system