Mustela lutreola (European mink): 131836470 Help Entry 131836470         CDS       T09578                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism mlk  Mustela lutreola (European mink) Pathway mlk04024   cAMP signaling pathway mlk04062   Chemokine signaling pathway mlk04064   NF-kappa B signaling pathway mlk04210   Apoptosis mlk04380   Osteoclast differentiation mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04622   RIG-I-like receptor signaling pathway mlk04623   Cytosolic DNA-sensing pathway mlk04625   C-type lectin receptor signaling pathway mlk04657   IL-17 signaling pathway mlk04658   Th1 and Th2 cell differentiation mlk04659   Th17 cell differentiation mlk04660   T cell receptor signaling pathway mlk04662   B cell receptor signaling pathway mlk04668   TNF signaling pathway mlk04722   Neurotrophin signaling pathway mlk04920   Adipocytokine signaling pathway mlk04926   Relaxin signaling pathway mlk04931   Insulin resistance mlk04936   Alcoholic liver disease mlk05132   Salmonella infection mlk05134   Legionellosis mlk05135   Yersinia infection mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05145   Toxoplasmosis mlk05160   Hepatitis C mlk05161   Hepatitis B mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05166   Human T-cell leukemia virus 1 infection mlk05167   Kaposi sarcoma-associated herpesvirus infection mlk05168   Herpes simplex virus 1 infection mlk05169   Epstein-Barr virus infection mlk05170   Human immunodeficiency virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05200   Pathways in cancer mlk05203   Viral carcinogenesis mlk05208   Chemical carcinogenesis - reactive oxygen species mlk05215   Prostate cancer mlk05220   Chronic myeloid leukemia mlk05222   Small cell lung cancer mlk05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mlk05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     131836470 (NFKBIA)    04668 TNF signaling pathway     131836470 (NFKBIA)    04024 cAMP signaling pathway     131836470 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     131836470 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     131836470 (NFKBIA)    04621 NOD-like receptor signaling pathway     131836470 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     131836470 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     131836470 (NFKBIA)    04625 C-type lectin receptor signaling pathway     131836470 (NFKBIA)    04660 T cell receptor signaling pathway     131836470 (NFKBIA)    04658 Th1 and Th2 cell differentiation     131836470 (NFKBIA)    04659 Th17 cell differentiation     131836470 (NFKBIA)    04657 IL-17 signaling pathway     131836470 (NFKBIA)    04662 B cell receptor signaling pathway     131836470 (NFKBIA)    04062 Chemokine signaling pathway     131836470 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     131836470 (NFKBIA)    04926 Relaxin signaling pathway     131836470 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     131836470 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     131836470 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     131836470 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     131836470 (NFKBIA)    05203 Viral carcinogenesis     131836470 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     131836470 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     131836470 (NFKBIA)    05215 Prostate cancer     131836470 (NFKBIA)    05222 Small cell lung cancer     131836470 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     131836470 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     131836470 (NFKBIA)    05161 Hepatitis B     131836470 (NFKBIA)    05160 Hepatitis C     131836470 (NFKBIA)    05171 Coronavirus disease - COVID-19     131836470 (NFKBIA)    05164 Influenza A     131836470 (NFKBIA)    05162 Measles     131836470 (NFKBIA)    05168 Herpes simplex virus 1 infection     131836470 (NFKBIA)    05163 Human cytomegalovirus infection     131836470 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     131836470 (NFKBIA)    05169 Epstein-Barr virus infection     131836470 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     131836470 (NFKBIA)    05135 Yersinia infection     131836470 (NFKBIA)    05134 Legionellosis     131836470 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     131836470 (NFKBIA)    05140 Leishmaniasis     131836470 (NFKBIA)    05142 Chagas disease     131836470 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131836470 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     131836470 (NFKBIA)    04931 Insulin resistance     131836470 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mlk03000]     131836470 (NFKBIA)    04131 Membrane trafficking [BR:mlk04131]     131836470 (NFKBIA) Transcription factors [BR:mlk03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     131836470 (NFKBIA) Membrane trafficking [BR:mlk04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     131836470 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  131836470 NCBI-ProteinID:  XP_059037894 LinkDB All DBs Position 7:complement(91292326..91295642) Genome browser AA seq 314 aa AA seqDB search MFQAAEHNQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQLVKELKEIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLSSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaggccgccgagcacaaccaggactgggccatggagggtccccgggacgcgctc aagaaggagcgcctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagttggtgaaggaactgaaggagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggcctttctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctggccagtgtg ggagtcctgactcagacctgcaggacccagcacctctcctccatcctccaggccactaac tacaatgggcacacgtgtctccatttagcctctatccatggttacttgggcattgtggaa cttctggtgtctctgggtgctgacgtcaatgctcaggagccctgcaatggccgaaccgcc ctccatctcgccgtggacctccagaattctgatctcgtgtcactcttgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccagagagcgaggatgaggagagctacgacacagagtccgagttcacggaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system