KEGG   Mustela lutreola (European mink): 131838926
Entry
131838926         CDS       T09578                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
mlk  Mustela lutreola (European mink)
Pathway
mlk01521  EGFR tyrosine kinase inhibitor resistance
mlk01522  Endocrine resistance
mlk04010  MAPK signaling pathway
mlk04012  ErbB signaling pathway
mlk04014  Ras signaling pathway
mlk04015  Rap1 signaling pathway
mlk04062  Chemokine signaling pathway
mlk04068  FoxO signaling pathway
mlk04071  Sphingolipid signaling pathway
mlk04072  Phospholipase D signaling pathway
mlk04137  Mitophagy - animal
mlk04140  Autophagy - animal
mlk04150  mTOR signaling pathway
mlk04151  PI3K-Akt signaling pathway
mlk04210  Apoptosis
mlk04211  Longevity regulating pathway
mlk04213  Longevity regulating pathway - multiple species
mlk04218  Cellular senescence
mlk04360  Axon guidance
mlk04370  VEGF signaling pathway
mlk04371  Apelin signaling pathway
mlk04540  Gap junction
mlk04550  Signaling pathways regulating pluripotency of stem cells
mlk04625  C-type lectin receptor signaling pathway
mlk04650  Natural killer cell mediated cytotoxicity
mlk04660  T cell receptor signaling pathway
mlk04662  B cell receptor signaling pathway
mlk04664  Fc epsilon RI signaling pathway
mlk04714  Thermogenesis
mlk04720  Long-term potentiation
mlk04722  Neurotrophin signaling pathway
mlk04725  Cholinergic synapse
mlk04726  Serotonergic synapse
mlk04730  Long-term depression
mlk04810  Regulation of actin cytoskeleton
mlk04910  Insulin signaling pathway
mlk04912  GnRH signaling pathway
mlk04914  Progesterone-mediated oocyte maturation
mlk04915  Estrogen signaling pathway
mlk04916  Melanogenesis
mlk04917  Prolactin signaling pathway
mlk04919  Thyroid hormone signaling pathway
mlk04921  Oxytocin signaling pathway
mlk04926  Relaxin signaling pathway
mlk04929  GnRH secretion
mlk04933  AGE-RAGE signaling pathway in diabetic complications
mlk04935  Growth hormone synthesis, secretion and action
mlk04960  Aldosterone-regulated sodium reabsorption
mlk05010  Alzheimer disease
mlk05022  Pathways of neurodegeneration - multiple diseases
mlk05034  Alcoholism
mlk05160  Hepatitis C
mlk05161  Hepatitis B
mlk05163  Human cytomegalovirus infection
mlk05165  Human papillomavirus infection
mlk05166  Human T-cell leukemia virus 1 infection
mlk05167  Kaposi sarcoma-associated herpesvirus infection
mlk05170  Human immunodeficiency virus 1 infection
mlk05200  Pathways in cancer
mlk05203  Viral carcinogenesis
mlk05205  Proteoglycans in cancer
mlk05206  MicroRNAs in cancer
mlk05207  Chemical carcinogenesis - receptor activation
mlk05208  Chemical carcinogenesis - reactive oxygen species
mlk05210  Colorectal cancer
mlk05211  Renal cell carcinoma
mlk05212  Pancreatic cancer
mlk05213  Endometrial cancer
mlk05214  Glioma
mlk05215  Prostate cancer
mlk05216  Thyroid cancer
mlk05218  Melanoma
mlk05219  Bladder cancer
mlk05220  Chronic myeloid leukemia
mlk05221  Acute myeloid leukemia
mlk05223  Non-small cell lung cancer
mlk05224  Breast cancer
mlk05225  Hepatocellular carcinoma
mlk05226  Gastric cancer
mlk05230  Central carbon metabolism in cancer
mlk05231  Choline metabolism in cancer
mlk05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mlk05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlk00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    131838926 (KRAS)
   04012 ErbB signaling pathway
    131838926 (KRAS)
   04014 Ras signaling pathway
    131838926 (KRAS)
   04015 Rap1 signaling pathway
    131838926 (KRAS)
   04370 VEGF signaling pathway
    131838926 (KRAS)
   04371 Apelin signaling pathway
    131838926 (KRAS)
   04068 FoxO signaling pathway
    131838926 (KRAS)
   04072 Phospholipase D signaling pathway
    131838926 (KRAS)
   04071 Sphingolipid signaling pathway
    131838926 (KRAS)
   04151 PI3K-Akt signaling pathway
    131838926 (KRAS)
   04150 mTOR signaling pathway
    131838926 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    131838926 (KRAS)
   04137 Mitophagy - animal
    131838926 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    131838926 (KRAS)
   04218 Cellular senescence
    131838926 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    131838926 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    131838926 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    131838926 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    131838926 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    131838926 (KRAS)
   04660 T cell receptor signaling pathway
    131838926 (KRAS)
   04662 B cell receptor signaling pathway
    131838926 (KRAS)
   04664 Fc epsilon RI signaling pathway
    131838926 (KRAS)
   04062 Chemokine signaling pathway
    131838926 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    131838926 (KRAS)
   04929 GnRH secretion
    131838926 (KRAS)
   04912 GnRH signaling pathway
    131838926 (KRAS)
   04915 Estrogen signaling pathway
    131838926 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    131838926 (KRAS)
   04917 Prolactin signaling pathway
    131838926 (KRAS)
   04921 Oxytocin signaling pathway
    131838926 (KRAS)
   04926 Relaxin signaling pathway
    131838926 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    131838926 (KRAS)
   04919 Thyroid hormone signaling pathway
    131838926 (KRAS)
   04916 Melanogenesis
    131838926 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    131838926 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    131838926 (KRAS)
   04726 Serotonergic synapse
    131838926 (KRAS)
   04720 Long-term potentiation
    131838926 (KRAS)
   04730 Long-term depression
    131838926 (KRAS)
   04722 Neurotrophin signaling pathway
    131838926 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    131838926 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    131838926 (KRAS)
   04213 Longevity regulating pathway - multiple species
    131838926 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    131838926 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    131838926 (KRAS)
   05206 MicroRNAs in cancer
    131838926 (KRAS)
   05205 Proteoglycans in cancer
    131838926 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    131838926 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    131838926 (KRAS)
   05203 Viral carcinogenesis
    131838926 (KRAS)
   05230 Central carbon metabolism in cancer
    131838926 (KRAS)
   05231 Choline metabolism in cancer
    131838926 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    131838926 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    131838926 (KRAS)
   05212 Pancreatic cancer
    131838926 (KRAS)
   05225 Hepatocellular carcinoma
    131838926 (KRAS)
   05226 Gastric cancer
    131838926 (KRAS)
   05214 Glioma
    131838926 (KRAS)
   05216 Thyroid cancer
    131838926 (KRAS)
   05221 Acute myeloid leukemia
    131838926 (KRAS)
   05220 Chronic myeloid leukemia
    131838926 (KRAS)
   05218 Melanoma
    131838926 (KRAS)
   05211 Renal cell carcinoma
    131838926 (KRAS)
   05219 Bladder cancer
    131838926 (KRAS)
   05215 Prostate cancer
    131838926 (KRAS)
   05213 Endometrial cancer
    131838926 (KRAS)
   05224 Breast cancer
    131838926 (KRAS)
   05223 Non-small cell lung cancer
    131838926 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    131838926 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    131838926 (KRAS)
   05161 Hepatitis B
    131838926 (KRAS)
   05160 Hepatitis C
    131838926 (KRAS)
   05163 Human cytomegalovirus infection
    131838926 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    131838926 (KRAS)
   05165 Human papillomavirus infection
    131838926 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    131838926 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    131838926 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    131838926 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    131838926 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    131838926 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    131838926 (KRAS)
   01522 Endocrine resistance
    131838926 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlk04131]
    131838926 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mlk04031]
    131838926 (KRAS)
Membrane trafficking [BR:mlk04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    131838926 (KRAS)
GTP-binding proteins [BR:mlk04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    131838926 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 131838926
NCBI-ProteinID: XP_059041775
LinkDB
Position
8:complement(81400451..81439524)
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKINKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgagtatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcaacaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgtaatgtaa

DBGET integrated database retrieval system