Mustela lutreola (European mink): 131839011 Help Entry 131839011         CDS       T09578                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism mlk  Mustela lutreola (European mink) Pathway mlk04613   Neutrophil extracellular trap formation mlk05034   Alcoholism mlk05203   Viral carcinogenesis mlk05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mlk00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     131839011  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     131839011   09163 Immune disease    05322 Systemic lupus erythematosus     131839011   09165 Substance dependence    05034 Alcoholism     131839011  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlk03036]     131839011 Chromosome and associated proteins [BR:mlk03036]  Eukaryotic type   Nucleosome assembly factors    Histones     131839011 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  131839011 NCBI-ProteinID:  XP_059041979 LinkDB All DBs Position 8:93348160..93348577 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcgggaaaggtggcaaagggctggggaagggaggcgccaagcggcaccgg aaagtcctccgggataacatccagggcatcacgaagcccgccatccgccggctcgcccgc cgaggtggtgtcaagcgcatttctgggctcatctacgaggagacccggggagtcctgaag gtcttcctggagaacgtgattcgcgacgcggtgacttataccgagcacgccaagcgcaag acggtcaccgctatggacgtggtgtacgcgctgaaacgccagggccgcaccttgtacggc ttcggcggctga

DBGET integrated database retrieval system