Mustela lutreola (European mink): 131840429 Help Entry 131840429         CDS       T09578                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism mlk  Mustela lutreola (European mink) Pathway mlk01523   Antifolate resistance mlk04010   MAPK signaling pathway mlk04060   Cytokine-cytokine receptor interaction mlk04064   NF-kappa B signaling pathway mlk04217   Necroptosis mlk04380   Osteoclast differentiation mlk04620   Toll-like receptor signaling pathway mlk04621   NOD-like receptor signaling pathway mlk04623   Cytosolic DNA-sensing pathway mlk04625   C-type lectin receptor signaling pathway mlk04640   Hematopoietic cell lineage mlk04657   IL-17 signaling pathway mlk04659   Th17 cell differentiation mlk04668   TNF signaling pathway mlk04750   Inflammatory mediator regulation of TRP channels mlk04932   Non-alcoholic fatty liver disease mlk04933   AGE-RAGE signaling pathway in diabetic complications mlk04936   Alcoholic liver disease mlk04940   Type I diabetes mellitus mlk05010   Alzheimer disease mlk05020   Prion disease mlk05022   Pathways of neurodegeneration - multiple diseases mlk05132   Salmonella infection mlk05133   Pertussis mlk05134   Legionellosis mlk05135   Yersinia infection mlk05140   Leishmaniasis mlk05142   Chagas disease mlk05143   African trypanosomiasis mlk05144   Malaria mlk05146   Amoebiasis mlk05152   Tuberculosis mlk05162   Measles mlk05163   Human cytomegalovirus infection mlk05164   Influenza A mlk05168   Herpes simplex virus 1 infection mlk05171   Coronavirus disease - COVID-19 mlk05321   Inflammatory bowel disease mlk05323   Rheumatoid arthritis mlk05332   Graft-versus-host disease mlk05417   Lipid and atherosclerosis mlk05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mlk00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131840429 (IL1B)    04064 NF-kappa B signaling pathway     131840429 (IL1B)    04668 TNF signaling pathway     131840429 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     131840429 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     131840429 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     131840429 (IL1B)    04620 Toll-like receptor signaling pathway     131840429 (IL1B)    04621 NOD-like receptor signaling pathway     131840429 (IL1B)    04623 Cytosolic DNA-sensing pathway     131840429 (IL1B)    04625 C-type lectin receptor signaling pathway     131840429 (IL1B)    04659 Th17 cell differentiation     131840429 (IL1B)    04657 IL-17 signaling pathway     131840429 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     131840429 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     131840429 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     131840429 (IL1B)    05164 Influenza A     131840429 (IL1B)    05162 Measles     131840429 (IL1B)    05168 Herpes simplex virus 1 infection     131840429 (IL1B)    05163 Human cytomegalovirus infection     131840429 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     131840429 (IL1B)    05135 Yersinia infection     131840429 (IL1B)    05133 Pertussis     131840429 (IL1B)    05134 Legionellosis     131840429 (IL1B)    05152 Tuberculosis     131840429 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     131840429 (IL1B)    05144 Malaria     131840429 (IL1B)    05140 Leishmaniasis     131840429 (IL1B)    05142 Chagas disease     131840429 (IL1B)    05143 African trypanosomiasis     131840429 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     131840429 (IL1B)    05321 Inflammatory bowel disease     131840429 (IL1B)    05332 Graft-versus-host disease     131840429 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     131840429 (IL1B)    05020 Prion disease     131840429 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     131840429 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     131840429 (IL1B)    05418 Fluid shear stress and atherosclerosis     131840429 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     131840429 (IL1B)    04936 Alcoholic liver disease     131840429 (IL1B)    04932 Non-alcoholic fatty liver disease     131840429 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     131840429 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     131840429 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mlk04052]     131840429 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:mlk00536]     131840429 (IL1B) Cytokines and neuropeptides [BR:mlk04052]  Cytokines   Interleukins    131840429 (IL1B) Glycosaminoglycan binding proteins [BR:mlk00536]  Heparan sulfate / Heparin   Cytokines    131840429 (IL1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1 IL1_propep Motif Other DBs NCBI-GeneID:  131840429 NCBI-ProteinID:  XP_059044345 LinkDB All DBs Position 9:108486983..108494978 Genome browser AA seq 270 aa AA seqDB search MARVPEPTSEVMSYGYSDNENDLFFEADGPGKMKCCFQDLNNSYLEEEGIQLQISHQLHN KSLSHFVSVIVALEKLKKISVPCSLPLQGDDLMNVFHCIFEEEPIILEKCDDNAFVHDAP PRSLDCKFQDINQKSLVLYNSYELRALHLNGTSVNQQAVFRMTFVQEDEDITKIPVALCI KEKNLYLSCVMKDGKPTLQLEMLDPKVYPKKRMEKRFVFNKTEIKKKVEFESSQFPNWYI STSQAEAMPVFLGNNRGGHDITDFTMELSS NT seq 813 nt NT seq  +upstreamnt  +downstreamnt atggcaagagtacctgaacccaccagtgaagtgatgtcttatggctacagtgacaatgag aatgaccttttctttgaggctgatggtcctggaaagatgaagtgctgcttccaagacctg aacaacagctatctggaagaggagggcatccagcttcaaatctcccaccagcttcataac aagagtctgagccattttgtgtcagtcattgtggctttggagaagctgaagaagatatct gtaccctgctcactgcccctccagggtgatgacctgatgaatgtttttcactgcatcttt gaagaagaacccatcatcttggaaaagtgtgatgataacgcctttgttcatgatgcaccc ccacgatccctggactgcaaattccaggacataaaccaaaaatccctggtgctgtataac tcgtatgagcttcgggcgctccacctcaacggaactagtgtgaaccaacaagcggtgttc cgcatgaccttcgtgcaagaagatgaagatattaccaagatacctgtggccttgtgcatc aaggaaaagaatctgtacctgtcctgtgtgatgaaagatgggaagcccaccttgcagctg gagatgttagaccccaaagtttacccaaagaagaggatggaaaagcgatttgtcttcaac aagacagaaatcaagaaaaaggtggaatttgagtcttctcagtttcccaactggtacatc agcacctctcaggcagaagcaatgcctgtcttcctgggaaataacagaggtggtcacgac ataactgacttcaccatggaactctcttcctag

DBGET integrated database retrieval system