Mycolicibacterium litorale: B1R94_20975 Help Entry B1R94_20975       CDS       T05032                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mll  Mycolicibacterium litorale Brite KEGG Orthology (KO) [BR:mll00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     B1R94_20975 Enzymes [BR:mll01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      B1R94_20975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Thioredoxin GST_N_2 Glrx-like GST_N_3 Motif Other DBs NCBI-ProteinID:  AQT81198 LinkDB All DBs Position 4414042..4414296 Genome browser AA seq 84 aa AA seqDB search MSDSAAQLTMYSTVWCGYCRRLKTQLKSAGIAFAEVDIEHDPAAAEFVMSVNDGNQTVPT VKFADGSALTNPSLKEVQAKLASV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagtgactctgctgcccagctcacgatgtacagcaccgtgtggtgcggctactgccgt cgcctcaagacccagctgaaatcggcgggtatcgcattcgccgaagtcgacatcgagcac gatccggccgctgccgagttcgtgatgtcggttaacgacggcaaccagacagtgccgacg gtcaagttcgcggacggcagcgcattgaccaacccaagcctcaaagaggtccaggccaag ctcgcgtcggtctag

DBGET integrated database retrieval system