Mycobacterium lepraemurium: MLM_0025 Help Entry MLM_0025          CDS       T05534                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlp  Mycobacterium lepraemurium Pathway mlp01100   Metabolic pathways mlp01110   Biosynthesis of secondary metabolites Module mlp_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mlp_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mlp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MLM_0025    00074 Mycolic acid biosynthesis     MLM_0025   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MLM_0025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ATA27172 LinkDB All DBs Position 27368..27643 Genome browser AA seq 91 aa AA seqDB search MVRVLASSNPPLLGAADDRLVSILRDDLDLKFESLSPTMRLIDDLRMGSVAFAISLVAIE ERFGTQLSKEDLLYCTPVGDLQSAIAARVNA NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggtccgggtactggcctcctccaatccaccactgctcggcgccgccgatgatcggttg gtcagcatccttcgcgacgacctggacctcaaattcgaatcactcagtcccacaatgcgt ctgatcgacgacctgagaatgggctcggtcgcgttcgccatcagcctggtcgccatcgaa gaacgcttcggtacgcagttgagcaaggaagacctgctgtattgcacgcccgtcggcgac ctgcagtccgcgatcgctgccagggtcaacgcatga

DBGET integrated database retrieval system