Marinobacter sp. LQ44: ASQ50_09265 Help Entry ASQ50_09265       CDS       T04470                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism mlq  Marinobacter sp. LQ44 Pathway mlq00361   Chlorocyclohexane and chlorobenzene degradation mlq00362   Benzoate degradation mlq00623   Toluene degradation mlq01100   Metabolic pathways mlq01120   Microbial metabolism in diverse environments mlq01220   Degradation of aromatic compounds Module mlq_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:mlq00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     ASQ50_09265    00361 Chlorocyclohexane and chlorobenzene degradation     ASQ50_09265    00623 Toluene degradation     ASQ50_09265 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Phenol_hyd_sub FLP26 Motif Other DBs NCBI-ProteinID:  AMQ88871 LinkDB All DBs Position complement(1981810..1982070) Genome browser AA seq 86 aa AA seqDB search MTNQPEAKTFNEMTRYIRVRSEPGDKFVEFDFAIGYPELFVELVLPREAFEIFCKHNNVV HMNSDMIREIDEDMVKWRFGERGQRY NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccagccagaagccaagacctttaacgaaatgacccgctatatccgggtccgc agcgagccaggtgacaaattcgtggaattcgattttgcgattggttatccggagctgttc gtcgagcttgtgctgccacgggaagccttcgagatcttctgcaagcacaacaacgtggtc catatgaattcggacatgatccgcgagatcgacgaagacatggtcaagtggcgcttcgga gagcgcggccagcgttattga

DBGET integrated database retrieval system