KEGG   Marinobacter sp. LQ44: ASQ50_18960
Entry
ASQ50_18960       CDS       T04470                                 
Name
(GenBank) chemotaxis response regulator protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq02020  Two-component system
mlq02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ASQ50_18960
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ASQ50_18960
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mlq02022]
    ASQ50_18960
   02035 Bacterial motility proteins [BR:mlq02035]
    ASQ50_18960
Enzymes [BR:mlq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ASQ50_18960
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     ASQ50_18960
Two-component system [BR:mlq02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   ASQ50_18960
Bacterial motility proteins [BR:mlq02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ASQ50_18960
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: AMQ90599
LinkDB
Position
4144598..4145758
AA seq 386 aa
MTVSVLVVDDSGFFRKRLTEILTASGQIEVVGAATNGREGVELAEKLRPDVITMDYEMPV
MDGISAVRLIMKKHPTPVLMFSSLTYEGARVTLDALEAGAVDFLPKNFEEIARDTSQLQK
ILIDRILDVAGSKPGGRSAAPVARPAAPRHGVSRPAAPQPPERPARPVTRDRSAPVQPEP
TREPETPRRPSRKAAPRHYSVVAIGTSTGGPVALQKVLAALPASFPAPIVLVQHMPASFT
PAFAERLNKLCRIQVKQAEDGDILKPGHALLAPGGKQMMIENRGGQARVRILPGDERLNY
KPCVDVTFGSLARSFPGKTLGVILTGMGADGKEGCRMMKQSGSVVWSQDEKSSVIYGMPM
AVAKAGLSDEILPLDEVGPRLVEGVS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacagtttctgtcctggttgttgatgattcagggttctttcgcaaacggctgacggaa
atcctcacggcctcggggcagatcgaggttgtcggtgcggcaaccaatggtcgtgaaggg
gtggagctggccgaaaagctgcgccctgatgtgattaccatggactacgaaatgcccgtg
atggatggcatttcggcggttcgtttaatcatgaaaaagcacccgaccccggtgttgatg
ttctcctctctgacgtatgagggcgcgcgggttactctggatgccctggaagccggggca
gtggacttcctgcccaagaacttcgaggaaattgcccgggataccagccaacttcagaaa
atcctcatcgatcggattcttgacgtggccggcagcaagcccggcggtcgttctgcggct
ccggttgcgcgcccggcagcgccgcgtcacggggtttcgcgcccggcagcgccgcagcct
ccagagcggcccgccagaccggtaacccgcgaccgctcagccccggtccagccagagccg
acccgcgagccggaaacgccaaggcggccctcccggaaagccgcaccaagacattacagc
gtggttgcaattggcacttccacaggaggaccggtggcgctgcagaaggtcttggccgca
ctgccggcgtcgttcccggctcccattgtgctggtgcagcacatgcctgccagttttacc
ccggcttttgccgagcgcctgaacaaactttgccgtattcaggtcaagcaggcagaggat
ggcgatatcctgaagcctggtcatgccctgttggcgcccggcggcaagcaaatgatgatc
gaaaatcgtggcggtcaggcgagggtcaggatcctgccgggtgacgaacggctgaactac
aaaccctgtgtggatgtcactttcggttctcttgcccgcagcttcccgggaaaaaccctg
ggcgtcatcctgacgggaatgggagcagacggtaaggaaggctgccggatgatgaagcag
tccggttcggtggtctggtcccaggacgagaaatcctcggtgatctacggcatgcccatg
gccgtcgccaaggccggattgagtgacgaaatcctgccgcttgatgaagtgggcccccgg
ctggttgaaggcgtgagctga

DBGET integrated database retrieval system