Marinobacter sp. LQ44: ASQ50_19540 Help Entry ASQ50_19540       CDS       T04470                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mlq  Marinobacter sp. LQ44 Pathway mlq01100   Metabolic pathways mlq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ASQ50_19540    00074 Mycolic acid biosynthesis     ASQ50_19540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ASQ50_19540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  AMQ90708 UniProt:  A0A142FW49 LinkDB All DBs Position 4266816..4267049 Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNTSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLGTVQDAIDYIVAHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgttaagaagattgtttgtgaacagttgggcgtgaaagag tccgaggttcagaacacatcttcttttgtagaggatcttggcgctgactcactggacact gttgagctggttatggccctggaagaggaattcgagactgaaattcctgatgaagaggcc gaaaagctgggcacggttcaggacgcgatcgactacatcgtcgcgcacacctga

DBGET integrated database retrieval system