Melampsora larici-populina: MELLADRAFT_29060 Help Entry MELLADRAFT_29060  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K03357   anaphase-promoting complex subunit 10 Organism mlr  Melampsora larici-populina Pathway mlr04111   Cell cycle - yeast mlr04113   Meiosis - yeast mlr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MELLADRAFT_29060  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     MELLADRAFT_29060    04113 Meiosis - yeast     MELLADRAFT_29060  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mlr04121]     MELLADRAFT_29060    03036 Chromosome and associated proteins [BR:mlr03036]     MELLADRAFT_29060 Ubiquitin system [BR:mlr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    APC/C     Other subunits      MELLADRAFT_29060 Chromosome and associated proteins [BR:mlr03036]  Eukaryotic type   Sister chromatid separation proteins    APC/C complex     MELLADRAFT_29060 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANAPC10 F5_F8_type_C_2 Motif Other DBs NCBI-GeneID:  18927051 NCBI-ProteinID:  XP_007413443 JGI:  Mellp1_29060 UniProt:  F4RWJ6 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search DLGDRAVWSVSSAKPGFGVAQLRDDSIHTLWQSEGPQPHFIRIEFPKKTAVSRISIFVDV SMDDSYTPCRLSIAVGSFKQDLQQIKQLDLRNPRGWQDIKLGHLFQIAVLANHLNGKDTH IRALKIFGPR NT seq 390 nt NT seq  +upstreamnt  +downstreamnt gatctaggagaccgagctgtttggtctgtttctagtgccaaacctggctttggcgttgct caactcagagatgattctattcatacgttgtggcaatcggaaggtcctcagcctcacttt atacggatcgaattccccaaaaagactgctgtttcacgtatttcgatatttgtggatgtc tcgatggatgactcctacacgccttgtcgcctttcgatagccgttggcagtttcaaacaa gatctacaacagatcaaacaacttgatttacgaaacccacgaggatggcaggacatcaag ctcggccacctgttccagatcgcggttttggccaatcaccttaatggaaaagacacccac atcagagcactcaaaatatttggcccgcga

DBGET integrated database retrieval system