Melampsora larici-populina: MELLADRAFT_34410 Help Entry MELLADRAFT_34410  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K11667   INO80 complex subunit C Organism mlr  Melampsora larici-populina Pathway mlr03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     MELLADRAFT_34410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mlr03036]     MELLADRAFT_34410 Chromosome and associated proteins [BR:mlr03036]  Eukaryotic type   Chromatin remodeling factors    INO80 complex     MELLADRAFT_34410    INO80 complex (yeast)     MELLADRAFT_34410 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  YL1_C Motif Other DBs NCBI-GeneID:  18927385 NCBI-ProteinID:  XP_007407212 JGI:  Mellp1_34410 UniProt:  F4RDY4 LinkDB All DBs Position Unknown AA seq 65 aa AA seqDB search MTIEAPPSVIPPKKYCDVTGLEAPYVDPKSRLRYHNVEVYELIKTFGPGVDQIYLSLRGA HTTLK NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgacgatcgaggcgcctccttcggttattcctccgaagaaatattgtgatgtgactgga ttagaagctccttatgttgatcctaaatctagattaagatatcataatgtagaagtatat gaattaattaaaacttttggacctggagttgatcaaatttatctttctttaagaggtgct catactactttaaaatga

DBGET integrated database retrieval system