Melampsora larici-populina: MELLADRAFT_41038 Help Entry MELLADRAFT_41038  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K13993   HSP20 family protein Organism mlr  Melampsora larici-populina Pathway mlr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     MELLADRAFT_41038  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mlr03110]     MELLADRAFT_41038 Chaperones and folding catalysts [BR:mlr03110]  Heat shock proteins   HSP20    MELLADRAFT_41038 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HSP20 ArsA_HSP20 Motif Other DBs NCBI-GeneID:  18927939 NCBI-ProteinID:  XP_007418646 JGI:  Mellp1_41038 UniProt:  F4SBB2 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search TVSSQTKSSSEHQTGNVRVSERSFGTFSRTIAVPEAITHDQIKASFTDGVLEVKVPKVKV DKETRRIQIS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt actgttagcagtcaaaccaagtcttcgtctgaacatcaaactggcaatgtccgagtttct gagcgatcctttggaaccttcagtcgcacaattgccgtccctgaagctatcacccatgat caaatcaaagctagcttcactgatggtgtcttagaagtcaaagttcccaaagtcaaagtc gacaaggaaacacgcaggattcaaatctcttaa

DBGET integrated database retrieval system