Melampsora larici-populina: MELLADRAFT_72433 Help Entry MELLADRAFT_72433  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K12625   U6 snRNA-associated Sm-like protein LSm6 Organism mlr  Melampsora larici-populina Pathway mlr03018   RNA degradation mlr03040   Spliceosome Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     MELLADRAFT_72433   09123 Folding, sorting and degradation    03018 RNA degradation     MELLADRAFT_72433  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mlr03019]     MELLADRAFT_72433    03041 Spliceosome [BR:mlr03041]     MELLADRAFT_72433 Messenger RNA biogenesis [BR:mlr03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      MELLADRAFT_72433   mRNA degradation factors    5'-3' decay     Lsm complex      MELLADRAFT_72433 Spliceosome [BR:mlr03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     MELLADRAFT_72433 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX LSM14 Motif Other DBs NCBI-GeneID:  18932101 NCBI-ProteinID:  XP_007412534 JGI:  Mellp1_72433 UniProt:  F4RTW2 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MADANGSTNEESTNATTTLTGGTPADFLKQVVGHEVVVRLNSGVDYRGILSCLDGYMNIA LENTEEYVNGIKRNSYGDAFVRGNNVLYISRVE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcggacgcaaacggctcgactaatgaagaatccaccaacgcaaccaccactttaacg gggggtactcccgctgacttcttgaagcaagtcgttggtcacgaagtggttgtgcggctg aacagtggtgtcgactatcgtggcattctctcctgcttggatggttacatgaacattgcg ctcgagaacacggaagaatatgtgaatgggattaagcggaatagctatggtgatgcattt gtacgggggaacaatgttctctatatcagccgagtcgagtga

DBGET integrated database retrieval system