Melampsora larici-populina: MELLADRAFT_84245 Help Entry MELLADRAFT_84245  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K12195   charged multivesicular body protein 6 Organism mlr  Melampsora larici-populina Pathway mlr03250   Viral life cycle - HIV-1 mlr04144   Endocytosis Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     MELLADRAFT_84245  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MELLADRAFT_84245  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlr04131]     MELLADRAFT_84245   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mlr04147]     MELLADRAFT_84245 Membrane trafficking [BR:mlr04131]  Endosome - Lysosome transport   Endosomal sorting complexes required for transport (ESCRT)    ESCRT-III complex     MELLADRAFT_84245 Exosome [BR:mlr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MELLADRAFT_84245   Exosomal proteins of other body fluids (saliva and urine)    MELLADRAFT_84245 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Snf7 YiiD_C Motif Other DBs NCBI-GeneID:  18933409 NCBI-ProteinID:  XP_007407995 JGI:  Mellp1_84245 UniProt:  F4RF11 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MNYNGPTPSNITKFGKVLSVEFSLIEKDVLFGLQQGNKVLKEVHKEMNLDSVEKLMSDTN EAIAYQREIDEMTMSKMNVEEEEEVEQELESLQAQENSQLKVQLSIPIDLPDAAKTCLPE LPNPVLEQVESQEPGKQLKAIPA NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgaattacaacggaccaacaccttcaaacattacaaaatttggtaaagttttgagtgtt gaattttcattgattgaaaaggatgtattgtttggtcttcaacaaggaaataaagtcttg aaggaagtacacaaagaaatgaatcttgacagtgtcgagaaactcatgagtgatactaat gaagcgattgcatatcaaagggagattgatgagatgacgatgtcaaagatgaatgtagag gaagaagaagaggttgaacaagaattggaatcattacaagcccaagagaactcacaactc aaagtccaactatctatcccaattgatctaccagatgctgccaagacttgtcttccagaa ctaccgaatccagttctagagcaggtggagtcacaagagcctggaaaacaactcaaagct atacctgcttaa

DBGET integrated database retrieval system