Melampsora larici-populina: MELLADRAFT_93550 Help Entry MELLADRAFT_93550  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism mlr  Melampsora larici-populina Pathway mlr03060   Protein export mlr04141   Protein processing in endoplasmic reticulum mlr04145   Phagosome Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MELLADRAFT_93550    04141 Protein processing in endoplasmic reticulum     MELLADRAFT_93550  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MELLADRAFT_93550  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlr04131]     MELLADRAFT_93550   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mlr02044]     MELLADRAFT_93550 Membrane trafficking [BR:mlr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MELLADRAFT_93550 Secretion system [BR:mlr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MELLADRAFT_93550 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE DUF3303 Motif Other DBs NCBI-GeneID:  18936612 NCBI-ProteinID:  XP_007406003 JGI:  Mellp1_93550 UniProt:  F4RAU0 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MEQVRELSELPQKFVKEGTQFMNRCTKPDQKEYVQICKAVAIGFAIMGFIGYFVKLIHIP INGILVGSA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaacaagtaagagaactcagtgaactgcctcaaaagttcgtaaaagaaggtactcaa tttatgaaccgatgtacaaaacctgatcaaaaagaatacgttcaaatctgtaaagctgta gctattggatttgccatcatgggttttattggatactttgttaaattgattcatattcct atcaatggtatcttagttggtagtgcataa

DBGET integrated database retrieval system