Methanosarcina lacustris: MSLAZ_0575 Help Entry MSLAZ_0575        CDS       T03822                                  Name (GenBank) LSU ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mls  Methanosarcina lacustris Pathway mls03010   Ribosome Brite KEGG Orthology (KO) [BR:mls00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSLAZ_0575   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSLAZ_0575  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mls03011]     MSLAZ_0575    04121 Ubiquitin system [BR:mls04121]     MSLAZ_0575 Ribosome [BR:mls03011]  Ribosomal proteins   Eukaryotes    Large subunit     MSLAZ_0575   Archaea     MSLAZ_0575 Ubiquitin system [BR:mls04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSLAZ_0575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR DZR_2 zf-AtTam37 Zn_ribbon_ZPR1 Zn_ribbon_RPAB4 Cas12f1-like_TNB Zn_ribbon_RanBP Zn_ribbon_3 zf-ChsH2 DHHC Motif Other DBs NCBI-ProteinID:  AKB73836 UniProt:  A0A0E3S1C4 LinkDB All DBs Position 702094..702243 Genome browser AA seq 49 aa AA seqDB search MGRFPEAEERLLNKQICMKCNARNAVRATRCRKCGYGALRVKSKESKGA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atgggtcgttttccagaagccgaagaaagattattaaacaaacaaatctgcatgaagtgt aatgccagaaatgccgtacgggcaacccgctgcagaaaatgcggctacggtgctcttcgc gtgaaatctaaggaatccaagggagcatga

DBGET integrated database retrieval system