Micrococcus luteus: Mlut_22520 Help Entry Mlut_22520        CDS       T00918                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mlu  Micrococcus luteus Brite KEGG Orthology (KO) [BR:mlu00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     Mlut_22520 Enzymes [BR:mlu01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      Mlut_22520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 GST_N_3 Thioredoxin_9 Thioredoxin_7 Motif Other DBs NCBI-ProteinID:  ACS31719 UniProt:  C5C7N1 LinkDB All DBs Position complement(2407536..2407796) Genome browser AA seq 86 aa AA seqDB search MSQNAPALTVYGADWCRDCLRTKRQLDELGVAYDYVDLVADPAQADAAERISGRTNIPVV VFPDGEHQVEPTNEETAAKLTALGLI NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagccagaacgcccccgccctcaccgtctacggcgccgactggtgccgcgactgcctg cgcaccaagcgccagctcgacgagctcggcgtcgcctacgactacgtggacctcgtggcc gaccccgcgcaggcggacgccgccgagcggatctcggggcgcacgaacatccccgtggtg gtcttccccgacggcgagcaccaggtcgagcccaccaatgaggagaccgcggcgaagctg accgcgctcggcctgatctga

DBGET integrated database retrieval system