KEGG   Martelella lutilitoris: JET14_15530
Entry
JET14_15530       CDS       T07693                                 
Name
(GenBank) tryptophan-rich sensory protein
  KO
K05770  translocator protein
Organism
mlut  Martelella lutilitoris
Brite
KEGG Orthology (KO) [BR:mlut00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mlut02000]
    JET14_15530
Transporters [BR:mlut02000]
 Other transporters
  Others
   JET14_15530
SSDB
Motif
Pfam: TspO_MBR
Other DBs
NCBI-ProteinID: QQM29699
UniProt: A0A7T7HIF4
LinkDB
Position
complement(3225953..3226408)
AA seq 151 aa
MKNILIHAVFIVGVVIAGFIVGIVNVPGEWYQSLAKPPFNPPNWVFAPAWSLLYVLIGWA
GARLFIARPQTSGALTLWSALLVLNLAWSPLFFGMEMPAAALVVVVALLAGILLFIARTW
GKDRPSAVLFVPYAAWVAFATLLNASIVYLN
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaaaaacattcttatccatgccgtcttcatcgtcggtgtcgtcattgcgggtttcatt
gtcggtatcgtcaatgtgccgggcgaatggtaccagtcgctcgccaagccgcccttcaat
ccgccgaactgggtcttcgcgcccgcctggagcctgctctatgtgctgatcggctgggcc
ggcgcgcggcttttcatcgcccggccgcaaacctccggcgcgctgacgctctggtcggcg
cttctggtgttgaaccttgcctggtcgccgctcttcttcggcatggaaatgccggccgcg
gcgctcgtggtcgtggtcgcgctccttgccggcatccttctgttcatcgcccgcacctgg
ggcaaggaccggccttcggccgtgctcttcgtgccctatgcggcctgggtcgccttcgcc
acgctgctcaacgcctcgatcgtttacctcaattga

DBGET integrated database retrieval system