Microbacterium lemovicicum: CVS47_01493 Help Entry CVS47_01493       CDS       T06301                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mlv  Microbacterium lemovicicum Pathway mlv01100   Metabolic pathways mlv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mlv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CVS47_01493 (acpP)    00074 Mycolic acid biosynthesis     CVS47_01493 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CVS47_01493 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AZS36877 UniProt:  A0A3Q9J3B1 LinkDB All DBs Position 1599314..1599559 Genome browser AA seq 81 aa AA seqDB search MAFTNDEVLAGLAELITDETGISADEVALEKSFTDDLDIDSISMMTIVVNAEEKFGVTIP DDEVKNLKTVGDAVTFISSNQ NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcattcaccaacgatgaggtgctggccggcctcgccgagctcatcaccgacgagacg ggcatctcggccgacgaggtcgccctcgagaagtcgttcaccgacgacctcgacatcgac tcgatctccatgatgacgatcgtcgtcaacgcggaggagaagttcggcgtcaccatcccc gacgacgaggtcaagaacctgaagaccgtcggcgacgccgtcaccttcatctcctcgaac cagtag

DBGET integrated database retrieval system