KEGG   Mirounga leonina (Southern elephant seal): 117999556
Entry
117999556         CDS       T07472                                 
Name
(RefSeq) integrin alpha-X-like isoform X1
  KO
K06462  integrin alpha X
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx04610  Complement and coagulation cascades
mlx04810  Regulation of actin cytoskeleton
mlx05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117999556
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    117999556
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    117999556
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mlx04515]
    117999556
   04090 CD molecules [BR:mlx04090]
    117999556
Cell adhesion molecules [BR:mlx04515]
 Integrins
  Integrin alpha subunits
   117999556
CD molecules [BR:mlx04090]
 Proteins
  117999556
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 117999556
NCBI-ProteinID: XP_034844681
LinkDB
Position
Unknown
AA seq 1164 aa
MSDLPVMTRTRTSLFLLMALSSSLCFNLDTDQPKTFLMDSAGFGHSVVQYGNTWVVVGAP
QEIKAANQTGSLYQCDYSMGKCEPIHLQIPPEAVNMSLGLSLAASTNPSQLLACGPTVHH
TCQENMYLTGFCFLLGSSSWQAQRLPAALQECPRQEQDIVFLIDGSSSISFHDFKKMLNF
VEAVMNQFQRPSTQFSLMQFSSNFQVHFTFKDFTYSSNPLVLLDSVRQLGGYTHTATAIQ
IVTNQLFSTSRGARKDASKILIVITDGQKKGDPLGYEDVIPMAEAAGIIRYAVGVGLAFQ
KKHSWKELNDIASKPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSAVFTPDGPVLGAVGSFSWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELAL
WKGVQSLILGAPRHQHTGKAVIFTQTSGQWRPKAEVAGTQIGSYFGASLCTVDVDGDGSS
DLVLIGAPYYYKPTRGGQVSVCPLPQGRAKWQCEVILCGEQGHPWGRFGAALTVLGDVNG
DKLTDVAIGAPGEQESRGAVYLFHGISGLGISTSHSQRISASQLSPSLQYFGQSLSGGQD
LTLDGLVDLAVGAHGQVLLLRTRPVLRVWMTIRFKPAEIARSLFECREETSSVNALGDAN
VCLHIYGSPKNRLGNLQSSVTFDLTLDPGRQSPRAIFEETKTWNLTRVRVLGLGQYCETV
KLLLLACVEDSVTPITLRLNFSLVGKPIPSFGSLRPMLAVDAQRYYTASLPFEKNCGADH
VCQDDLGISFGVSGLKTLLVGSTREINMKVKVWNDGEDSYGTTVTFFYPPGLSYRRVAAS
KLQPHSPHLTCDGTPAQGQGIQSTRCSINHFILPEGAQVTFLVTFDVSPKAMLGDRLLLT
ANVSSENNTPRTSKSTFQMELMVKYAIYTVISSHEQSTKYLNFSASDQEESSQAQHRYQV
NNLGQRDLPISIIFSVPMELNGVPVWRELEVFHPQNPSIQCSSERIVHRESDFLTHIQKN
SVLDCSIADCLRFCCDLPSFGIQEELDFILKGNLSFGWVSQTLQKKVLVTTVAEITFNRS
VYSQLPGQEAFLRAQVETVLEKYEVYNPIPIIVGSSVGGLLLLALITAILYKVGFFKRQY
KEMMVETNGQSVPENGTSDPQVAQ
NT seq 3495 nt   +upstreamnt  +downstreamnt
atgtctgaccttccagtcatgaccaggaccagaacatccctctttctgttgatggccttg
tcttcttctctctgcttcaacttggacacggaccagccaaaaaccttccttatggacagt
gctggatttggacacagcgtggtccagtatggcaatacctgggtggtggttggagcccct
caggagataaaggctgccaaccaaacaggcagcctctaccagtgtgactacagcatgggc
aagtgtgagcccatccacctgcagattcccccagaagctgtgaacatgtccctgggcctg
tccctggcagcctccactaacccctctcagttgctggcctgtggccccacagtgcaccat
acatgccaggagaacatgtacttgactggcttctgcttcctgctgggctcctcttcctgg
caagcccagaggctcccggctgccctgcaggagtgtcccaggcaagagcaagatatcgtg
ttcctgatcgatggctcgagcagcatctccttccatgattttaaaaagatgctgaatttc
gtggaggctgtgatgaatcagttccagagacctagcacccagttctccctgatgcagttt
tccagcaatttccaggtgcacttcactttcaaagacttcacatacagctcaaacccacta
gtcctgttggattctgtacgccagctgggagggtatactcacacagccacagccatccaa
atagtcacaaaccaactgttcagtacctcaagaggggcccgaaaagatgcctccaagatc
ctcattgtcatcaccgacgggcaaaaaaaaggcgaccccctgggttatgaggatgtcatc
cctatggctgaagctgcgggtatcatccgttatgcagttggggtgggattggcttttcaa
aagaaacattcttggaaagaattaaatgacattgcatcgaagccctcccatgagtacatt
tttaaagtggagaattttgatgctttgagagacattcaaaaccaactgaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttcctttgaattggagatgtcccag
gagggcttcagcgctgtgttcacacctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcctgtaccccccaaatatgagccccactttcatcaacatg
tctcaagagaatgtggacatgagggactcttacctgggttactccactgagctggctctt
tggaagggggtccagagcctgatcctgggggccccccgccatcaacatactgggaaggct
gtcatcttcacccagacgtctgggcaatggaggccaaaggctgaagtcgcagggactcag
attggctcctactttggggcctccctctgcactgtggatgtggatggagatggcagctct
gaccttgtcctcattggggctccctattactacaagccgacccgggggggccaggtgtct
gtgtgtcccttgccccaggggagggctaagtggcagtgtgaggtcattctctgtggggag
cagggccacccctggggccgctttggggcagccctgacagtgctgggggatgtgaatggg
gacaagctgacagacgtggccattggggccccaggagagcaggagagccggggtgctgtc
tacttatttcatggaatctcaggactgggcatcagcacctcccacagtcagaggatctca
gcctcccagctctcccccagcctccagtattttgggcagtcactgagtgggggtcaggac
cttaccctggatggactggtggacctggccgtgggggcccatgggcaggtgctgctgctc
aggaccagacctgtactcagggtgtggatgaccatccgattcaaacctgcagagatagcc
aggtctctgtttgagtgtcgggaggagacctcctctgtcaatgcactgggcgacgccaat
gtctgtcttcatatttatggaagtcccaagaatcggctgggtaacctccagagctctgtg
acctttgacctgaccctcgacccaggccgccagagtcctcgtgccatctttgaggagaca
aagacctggaatctgactcgtgtccgagtccttgggctgggacagtactgtgagactgtg
aagttgctcctcctggcctgtgtggaggactcagtgacccccatcaccttgcgtctcaac
ttctccctggtgggcaagcctatcccttcctttggaagcctccggcctatgttggctgtg
gatgctcagagatactacacagcctctctcccctttgagaagaattgtggagctgaccat
gtctgccaggatgaccttggcatctcctttggcgtctcaggcttgaagacgctgttggtg
gggagtacccgggagataaatatgaaagtgaaggtgtggaatgatggtgaggactcctat
ggaaccacagtcaccttcttctatccaccagggctgtcttatcgacgtgtggcagctagc
aagctgcagccacactccccacacctgacctgtgatggcaccccagcccagggccagggt
attcagagcacccgctgcagcatcaaccacttcatcctccctgagggtgcccaggtcacc
ttcttggtcacctttgatgtctcccccaaggccatgctgggagaccggctgcttctgaca
gctaatgtgagcagtgaaaataacactcccaggaccagcaagagcacctttcagatggag
ctcatggtgaagtatgccatctacaccgtgatcagcagccatgaacagtccaccaagtac
ctcaacttctcagcctcagaccaggaggaaagcagccaggctcagcatagataccaggtg
aacaacctgggacagagggacctgcctatcagcatcatcttctccgtgcctatggagctg
aatggggtacctgtgtggagagaattagaggtcttccacccccagaatccctccattcag
tgttcttcagagagaatagtgcacagagagtctgacttcctgacccacattcagaaaaat
tctgtgctggactgctccattgctgactgtctgaggttctgctgtgacctcccctccttt
ggcattcaggaggaacttgacttcattctgaagggcaacctcagttttggttgggtcagc
cagacattgcagaagaaggtattggtaacgactgtggctgaaatcacattcaacagatcc
gtgtattcccagcttccaggacaggaggcattcttgagagctcaggtggagacggtgttg
gagaagtatgaggtctacaaccccatccccattattgtgggcagctctgtgggagggctg
ctactgctggctctcatcacagccatcctgtacaaggttggcttcttcaaacgtcagtat
aaggaaatgatggtggaaaccaatgggcagtctgtcccagaaaatgggacttcagaccct
caagttgcccaataa

DBGET integrated database retrieval system