KEGG   Mirounga leonina (Southern elephant seal): 117999637
Entry
117999637         CDS       T07472                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx01521  EGFR tyrosine kinase inhibitor resistance
mlx01522  Endocrine resistance
mlx01524  Platinum drug resistance
mlx04010  MAPK signaling pathway
mlx04012  ErbB signaling pathway
mlx04014  Ras signaling pathway
mlx04015  Rap1 signaling pathway
mlx04022  cGMP-PKG signaling pathway
mlx04024  cAMP signaling pathway
mlx04062  Chemokine signaling pathway
mlx04066  HIF-1 signaling pathway
mlx04068  FoxO signaling pathway
mlx04071  Sphingolipid signaling pathway
mlx04072  Phospholipase D signaling pathway
mlx04114  Oocyte meiosis
mlx04140  Autophagy - animal
mlx04148  Efferocytosis
mlx04150  mTOR signaling pathway
mlx04151  PI3K-Akt signaling pathway
mlx04210  Apoptosis
mlx04218  Cellular senescence
mlx04261  Adrenergic signaling in cardiomyocytes
mlx04270  Vascular smooth muscle contraction
mlx04350  TGF-beta signaling pathway
mlx04360  Axon guidance
mlx04370  VEGF signaling pathway
mlx04371  Apelin signaling pathway
mlx04380  Osteoclast differentiation
mlx04510  Focal adhesion
mlx04520  Adherens junction
mlx04540  Gap junction
mlx04550  Signaling pathways regulating pluripotency of stem cells
mlx04611  Platelet activation
mlx04613  Neutrophil extracellular trap formation
mlx04620  Toll-like receptor signaling pathway
mlx04621  NOD-like receptor signaling pathway
mlx04625  C-type lectin receptor signaling pathway
mlx04650  Natural killer cell mediated cytotoxicity
mlx04657  IL-17 signaling pathway
mlx04658  Th1 and Th2 cell differentiation
mlx04659  Th17 cell differentiation
mlx04660  T cell receptor signaling pathway
mlx04662  B cell receptor signaling pathway
mlx04664  Fc epsilon RI signaling pathway
mlx04666  Fc gamma R-mediated phagocytosis
mlx04668  TNF signaling pathway
mlx04713  Circadian entrainment
mlx04720  Long-term potentiation
mlx04722  Neurotrophin signaling pathway
mlx04723  Retrograde endocannabinoid signaling
mlx04724  Glutamatergic synapse
mlx04725  Cholinergic synapse
mlx04726  Serotonergic synapse
mlx04730  Long-term depression
mlx04810  Regulation of actin cytoskeleton
mlx04910  Insulin signaling pathway
mlx04912  GnRH signaling pathway
mlx04914  Progesterone-mediated oocyte maturation
mlx04915  Estrogen signaling pathway
mlx04916  Melanogenesis
mlx04917  Prolactin signaling pathway
mlx04919  Thyroid hormone signaling pathway
mlx04921  Oxytocin signaling pathway
mlx04926  Relaxin signaling pathway
mlx04928  Parathyroid hormone synthesis, secretion and action
mlx04929  GnRH secretion
mlx04930  Type II diabetes mellitus
mlx04933  AGE-RAGE signaling pathway in diabetic complications
mlx04934  Cushing syndrome
mlx04935  Growth hormone synthesis, secretion and action
mlx04960  Aldosterone-regulated sodium reabsorption
mlx05010  Alzheimer disease
mlx05020  Prion disease
mlx05022  Pathways of neurodegeneration - multiple diseases
mlx05034  Alcoholism
mlx05132  Salmonella infection
mlx05133  Pertussis
mlx05135  Yersinia infection
mlx05140  Leishmaniasis
mlx05142  Chagas disease
mlx05145  Toxoplasmosis
mlx05152  Tuberculosis
mlx05160  Hepatitis C
mlx05161  Hepatitis B
mlx05163  Human cytomegalovirus infection
mlx05164  Influenza A
mlx05165  Human papillomavirus infection
mlx05166  Human T-cell leukemia virus 1 infection
mlx05167  Kaposi sarcoma-associated herpesvirus infection
mlx05170  Human immunodeficiency virus 1 infection
mlx05171  Coronavirus disease - COVID-19
mlx05200  Pathways in cancer
mlx05203  Viral carcinogenesis
mlx05205  Proteoglycans in cancer
mlx05206  MicroRNAs in cancer
mlx05207  Chemical carcinogenesis - receptor activation
mlx05208  Chemical carcinogenesis - reactive oxygen species
mlx05210  Colorectal cancer
mlx05211  Renal cell carcinoma
mlx05212  Pancreatic cancer
mlx05213  Endometrial cancer
mlx05214  Glioma
mlx05215  Prostate cancer
mlx05216  Thyroid cancer
mlx05218  Melanoma
mlx05219  Bladder cancer
mlx05220  Chronic myeloid leukemia
mlx05221  Acute myeloid leukemia
mlx05223  Non-small cell lung cancer
mlx05224  Breast cancer
mlx05225  Hepatocellular carcinoma
mlx05226  Gastric cancer
mlx05230  Central carbon metabolism in cancer
mlx05231  Choline metabolism in cancer
mlx05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mlx05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    117999637 (MAPK3)
   04012 ErbB signaling pathway
    117999637 (MAPK3)
   04014 Ras signaling pathway
    117999637 (MAPK3)
   04015 Rap1 signaling pathway
    117999637 (MAPK3)
   04350 TGF-beta signaling pathway
    117999637 (MAPK3)
   04370 VEGF signaling pathway
    117999637 (MAPK3)
   04371 Apelin signaling pathway
    117999637 (MAPK3)
   04668 TNF signaling pathway
    117999637 (MAPK3)
   04066 HIF-1 signaling pathway
    117999637 (MAPK3)
   04068 FoxO signaling pathway
    117999637 (MAPK3)
   04072 Phospholipase D signaling pathway
    117999637 (MAPK3)
   04071 Sphingolipid signaling pathway
    117999637 (MAPK3)
   04024 cAMP signaling pathway
    117999637 (MAPK3)
   04022 cGMP-PKG signaling pathway
    117999637 (MAPK3)
   04151 PI3K-Akt signaling pathway
    117999637 (MAPK3)
   04150 mTOR signaling pathway
    117999637 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    117999637 (MAPK3)
   04148 Efferocytosis
    117999637 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    117999637 (MAPK3)
   04210 Apoptosis
    117999637 (MAPK3)
   04218 Cellular senescence
    117999637 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    117999637 (MAPK3)
   04520 Adherens junction
    117999637 (MAPK3)
   04540 Gap junction
    117999637 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    117999637 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    117999637 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    117999637 (MAPK3)
   04613 Neutrophil extracellular trap formation
    117999637 (MAPK3)
   04620 Toll-like receptor signaling pathway
    117999637 (MAPK3)
   04621 NOD-like receptor signaling pathway
    117999637 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    117999637 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    117999637 (MAPK3)
   04660 T cell receptor signaling pathway
    117999637 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    117999637 (MAPK3)
   04659 Th17 cell differentiation
    117999637 (MAPK3)
   04657 IL-17 signaling pathway
    117999637 (MAPK3)
   04662 B cell receptor signaling pathway
    117999637 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    117999637 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    117999637 (MAPK3)
   04062 Chemokine signaling pathway
    117999637 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    117999637 (MAPK3)
   04929 GnRH secretion
    117999637 (MAPK3)
   04912 GnRH signaling pathway
    117999637 (MAPK3)
   04915 Estrogen signaling pathway
    117999637 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    117999637 (MAPK3)
   04917 Prolactin signaling pathway
    117999637 (MAPK3)
   04921 Oxytocin signaling pathway
    117999637 (MAPK3)
   04926 Relaxin signaling pathway
    117999637 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    117999637 (MAPK3)
   04919 Thyroid hormone signaling pathway
    117999637 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    117999637 (MAPK3)
   04916 Melanogenesis
    117999637 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    117999637 (MAPK3)
   04270 Vascular smooth muscle contraction
    117999637 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    117999637 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    117999637 (MAPK3)
   04725 Cholinergic synapse
    117999637 (MAPK3)
   04726 Serotonergic synapse
    117999637 (MAPK3)
   04720 Long-term potentiation
    117999637 (MAPK3)
   04730 Long-term depression
    117999637 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    117999637 (MAPK3)
   04722 Neurotrophin signaling pathway
    117999637 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    117999637 (MAPK3)
   04380 Osteoclast differentiation
    117999637 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    117999637 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    117999637 (MAPK3)
   05206 MicroRNAs in cancer
    117999637 (MAPK3)
   05205 Proteoglycans in cancer
    117999637 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    117999637 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    117999637 (MAPK3)
   05203 Viral carcinogenesis
    117999637 (MAPK3)
   05230 Central carbon metabolism in cancer
    117999637 (MAPK3)
   05231 Choline metabolism in cancer
    117999637 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    117999637 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    117999637 (MAPK3)
   05212 Pancreatic cancer
    117999637 (MAPK3)
   05225 Hepatocellular carcinoma
    117999637 (MAPK3)
   05226 Gastric cancer
    117999637 (MAPK3)
   05214 Glioma
    117999637 (MAPK3)
   05216 Thyroid cancer
    117999637 (MAPK3)
   05221 Acute myeloid leukemia
    117999637 (MAPK3)
   05220 Chronic myeloid leukemia
    117999637 (MAPK3)
   05218 Melanoma
    117999637 (MAPK3)
   05211 Renal cell carcinoma
    117999637 (MAPK3)
   05219 Bladder cancer
    117999637 (MAPK3)
   05215 Prostate cancer
    117999637 (MAPK3)
   05213 Endometrial cancer
    117999637 (MAPK3)
   05224 Breast cancer
    117999637 (MAPK3)
   05223 Non-small cell lung cancer
    117999637 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    117999637 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    117999637 (MAPK3)
   05161 Hepatitis B
    117999637 (MAPK3)
   05160 Hepatitis C
    117999637 (MAPK3)
   05171 Coronavirus disease - COVID-19
    117999637 (MAPK3)
   05164 Influenza A
    117999637 (MAPK3)
   05163 Human cytomegalovirus infection
    117999637 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    117999637 (MAPK3)
   05165 Human papillomavirus infection
    117999637 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    117999637 (MAPK3)
   05135 Yersinia infection
    117999637 (MAPK3)
   05133 Pertussis
    117999637 (MAPK3)
   05152 Tuberculosis
    117999637 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    117999637 (MAPK3)
   05140 Leishmaniasis
    117999637 (MAPK3)
   05142 Chagas disease
    117999637 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    117999637 (MAPK3)
   05020 Prion disease
    117999637 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    117999637 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    117999637 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    117999637 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    117999637 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    117999637 (MAPK3)
   04934 Cushing syndrome
    117999637 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    117999637 (MAPK3)
   01524 Platinum drug resistance
    117999637 (MAPK3)
   01522 Endocrine resistance
    117999637 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlx01001]
    117999637 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mlx03036]
    117999637 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlx04147]
    117999637 (MAPK3)
Enzymes [BR:mlx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     117999637 (MAPK3)
Protein kinases [BR:mlx01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   117999637 (MAPK3)
Chromosome and associated proteins [BR:mlx03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     117999637 (MAPK3)
Exosome [BR:mlx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   117999637 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 117999637
NCBI-ProteinID: XP_034844837
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAY
DHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccc
cgctacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctccgcttac
gaccacgtgcgcaagattcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgcgagatccagatcttgctgcgcttccgccacgagaacgtc
attggcattcgggacattctgcgggcacccaccctggaagccatgagggatgtctacatc
gtgcaggacctgatggagacagacctctacaagttgctgaaaagccagcagctgagcaac
gaccatgtttgctacttcctctaccagatcttgcggggcctcaagtatatccactcagcc
aacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggattgccgatcctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctctccatcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactac
ctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcagac
tccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaagaagcactggctcacccctacttggagcagtactacgacccaacagatgagcca
gtggctgaggagcctttcaccttcgacatggagctggatgatctacccaaggaacggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system