KEGG   Mirounga leonina (Southern elephant seal): 118001199
Entry
118001199         CDS       T07472                                 
Symbol
IL17A
Name
(RefSeq) interleukin-17A
  KO
K05489  interleukin 17A
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx04060  Cytokine-cytokine receptor interaction
mlx04657  IL-17 signaling pathway
mlx04659  Th17 cell differentiation
mlx04936  Alcoholic liver disease
mlx05321  Inflammatory bowel disease
mlx05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    118001199 (IL17A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    118001199 (IL17A)
   04657 IL-17 signaling pathway
    118001199 (IL17A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    118001199 (IL17A)
   05321 Inflammatory bowel disease
    118001199 (IL17A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    118001199 (IL17A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:mlx04052]
    118001199 (IL17A)
Cytokines and neuropeptides [BR:mlx04052]
 Cytokines
  Interleukins
   118001199 (IL17A)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 118001199
NCBI-ProteinID: XP_034847104
LinkDB
Position
Unknown
AA seq 155 aa
MAPVTVSSMFRVLLLLLSLVALGKAGIALPQNPGCPNTEDKNFPQHVKVNLNILNQNTNS
RRPSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNAEGKINYHMNSVPIQQEIL
VLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctcctgtgacagtttcatccatgttccgggtactgctgctgctgctgagcctggtg
gctcttgggaaggcgggaatagcactcccacaaaatccaggatgcccaaatactgaggac
aagaacttccctcagcatgtgaaggtcaatctaaatatccttaaccagaatacgaactcc
agaaggccctcagattactacaaccgatccacttcaccttggaatctgcaccgcaatgag
gaccctgagagatacccctctgtgatctgggaggccaagtgccgccacttgggctgtgtc
aatgctgaagggaagataaactaccacatgaactctgtccccattcagcaagagatcctt
gttctgcgaagggagtctcagcactgcccccactccttccggctggagaagatgctggtg
gccgtgggctgcacctgcgtcacccccattgtgcgccatgtagcttaa

DBGET integrated database retrieval system