Mirounga leonina (Southern elephant seal): 118001917
Help
Entry
118001917 CDS
T07472
Name
(RefSeq) 39S ribosomal protein L18, mitochondrial-like isoform X1
KO
K02881
large subunit ribosomal protein L18
Organism
mlx
Mirounga leonina (Southern elephant seal)
Pathway
mlx03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
mlx00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
118001917
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
mlx03011
]
118001917
Ribosome [BR:
mlx03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
118001917
Bacteria
118001917
Archaea
118001917
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Ribosomal_L18p
Motif
Other DBs
NCBI-GeneID:
118001917
NCBI-ProteinID:
XP_034847992
LinkDB
All DBs
Position
Unknown
AA seq
180 aa
AA seq
DB search
MALRSRLWGKLSVCRNPGCGVAALSTSCEPAAKPEVDPLENAAVAPEFTNRNPRNLELLG
VARKERGWGTTWPSREFWHRLRVIRTQHHVEALVEHRNGQVVVSASTREWAIKKHLYSTK
NVVACESIGRVLAERCLEAGINFMVYQPTPWEAASDSMKRLQGAMTEGGVVLQEPRRIYD
NT seq
543 nt
NT seq
+upstream
nt +downstream
nt
atggcgctccggtcgcggctctgggggaagctgtcggtttgcaggaaccccgggtgtggg
gtcgcagcgctctcaaccagttgcgagccagcggcgaagcctgaagtggaccccctggaa
aatgccgctgttgccccagagttcaccaatcggaacccccgcaatctggagctcttaggt
gtggccaggaaggagcggggttgggggacaacgtggccctcccgtgagttctggcacagg
ttgcgagttataaggactcagcatcatgtagaagcgttggttgagcatcgcaacggccag
gttgtggtttcagcatccactcgggaatgggctattaaaaagcatctttacagcaccaaa
aacgtggtggcctgtgagagtataggacgagtgctggcagagcgatgcttagaggcagga
atcaacttcatggtctaccaacccactccttgggaggcagcctcggactcgatgaagcga
ctgcagggtgccatgacggaaggcggtgtggtgctgcaggagcctcggagaatctatgac
tga
DBGET
integrated database retrieval system