KEGG   Mirounga leonina (Southern elephant seal): 118012486
Entry
118012486         CDS       T07472                                 
Name
(RefSeq) calmodulin-like
  KO
K02183  calmodulin
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx04014  Ras signaling pathway
mlx04015  Rap1 signaling pathway
mlx04020  Calcium signaling pathway
mlx04022  cGMP-PKG signaling pathway
mlx04024  cAMP signaling pathway
mlx04070  Phosphatidylinositol signaling system
mlx04114  Oocyte meiosis
mlx04218  Cellular senescence
mlx04261  Adrenergic signaling in cardiomyocytes
mlx04270  Vascular smooth muscle contraction
mlx04371  Apelin signaling pathway
mlx04625  C-type lectin receptor signaling pathway
mlx04713  Circadian entrainment
mlx04720  Long-term potentiation
mlx04722  Neurotrophin signaling pathway
mlx04728  Dopaminergic synapse
mlx04740  Olfactory transduction
mlx04744  Phototransduction
mlx04750  Inflammatory mediator regulation of TRP channels
mlx04910  Insulin signaling pathway
mlx04912  GnRH signaling pathway
mlx04915  Estrogen signaling pathway
mlx04916  Melanogenesis
mlx04921  Oxytocin signaling pathway
mlx04922  Glucagon signaling pathway
mlx04924  Renin secretion
mlx04925  Aldosterone synthesis and secretion
mlx04970  Salivary secretion
mlx04971  Gastric acid secretion
mlx05010  Alzheimer disease
mlx05012  Parkinson disease
mlx05022  Pathways of neurodegeneration - multiple diseases
mlx05031  Amphetamine addiction
mlx05034  Alcoholism
mlx05133  Pertussis
mlx05152  Tuberculosis
mlx05163  Human cytomegalovirus infection
mlx05167  Kaposi sarcoma-associated herpesvirus infection
mlx05170  Human immunodeficiency virus 1 infection
mlx05200  Pathways in cancer
mlx05214  Glioma
mlx05417  Lipid and atherosclerosis
mlx05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    118012486
   04015 Rap1 signaling pathway
    118012486
   04371 Apelin signaling pathway
    118012486
   04020 Calcium signaling pathway
    118012486
   04070 Phosphatidylinositol signaling system
    118012486
   04024 cAMP signaling pathway
    118012486
   04022 cGMP-PKG signaling pathway
    118012486
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    118012486
   04218 Cellular senescence
    118012486
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    118012486
  09152 Endocrine system
   04910 Insulin signaling pathway
    118012486
   04922 Glucagon signaling pathway
    118012486
   04912 GnRH signaling pathway
    118012486
   04915 Estrogen signaling pathway
    118012486
   04921 Oxytocin signaling pathway
    118012486
   04916 Melanogenesis
    118012486
   04924 Renin secretion
    118012486
   04925 Aldosterone synthesis and secretion
    118012486
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    118012486
   04270 Vascular smooth muscle contraction
    118012486
  09154 Digestive system
   04970 Salivary secretion
    118012486
   04971 Gastric acid secretion
    118012486
  09156 Nervous system
   04728 Dopaminergic synapse
    118012486
   04720 Long-term potentiation
    118012486
   04722 Neurotrophin signaling pathway
    118012486
  09157 Sensory system
   04744 Phototransduction
    118012486
   04740 Olfactory transduction
    118012486
   04750 Inflammatory mediator regulation of TRP channels
    118012486
  09159 Environmental adaptation
   04713 Circadian entrainment
    118012486
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    118012486
  09162 Cancer: specific types
   05214 Glioma
    118012486
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    118012486
   05163 Human cytomegalovirus infection
    118012486
   05167 Kaposi sarcoma-associated herpesvirus infection
    118012486
  09171 Infectious disease: bacterial
   05133 Pertussis
    118012486
   05152 Tuberculosis
    118012486
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    118012486
   05012 Parkinson disease
    118012486
   05022 Pathways of neurodegeneration - multiple diseases
    118012486
  09165 Substance dependence
   05031 Amphetamine addiction
    118012486
   05034 Alcoholism
    118012486
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    118012486
   05418 Fluid shear stress and atherosclerosis
    118012486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mlx01009]
    118012486
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlx04131]
    118012486
   03036 Chromosome and associated proteins [BR:mlx03036]
    118012486
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlx04147]
    118012486
Protein phosphatases and associated proteins [BR:mlx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     118012486
Membrane trafficking [BR:mlx04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    118012486
Chromosome and associated proteins [BR:mlx03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     118012486
Exosome [BR:mlx04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   118012486
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_9 EF-hand_5 EF_EFCAB10_C AIF-1 EF-hand_FSTL1 FCaBP_EF-hand SPEF2_C UPF0154 EFhand_Ca_insen
Other DBs
NCBI-GeneID: 118012486
NCBI-ProteinID: XP_034864010
LinkDB
Position
Unknown
AA seq 95 aa
MRSFGQNPTEAELQDMINEVDADGNGTVDFPQFLTMMARKMKDTDSEEEIREAFHVFDKE
GTGFISAAEFCHGITNLGEKLTDEEVDEMIREAGY
NT seq 288 nt   +upstreamnt  +downstreamnt
atgaggtcttttgggcaaaatcccacagaagcagagttacaggacatgattaatgaagta
gatgctgatggtaatggcacagttgacttcccgcaatttctgacaatgatggcaagaaaa
atgaaagacacagacagtgaagaagaaattagagaagcattccatgtgtttgataaggaa
ggcactggctttattagtgcagcagagttttgccatgggataacaaatctgggagagaag
ttaacagatgaagaggttgatgaaatgatcagggaagcaggatattga

DBGET integrated database retrieval system