Mirounga leonina (Southern elephant seal): 118016639
Help
Entry
118016639 CDS
T07472
Symbol
SKP1
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
mlx
Mirounga leonina (Southern elephant seal)
Pathway
mlx03083
Polycomb repressive complex
mlx04110
Cell cycle
mlx04114
Oocyte meiosis
mlx04120
Ubiquitin mediated proteolysis
mlx04141
Protein processing in endoplasmic reticulum
mlx04310
Wnt signaling pathway
mlx04350
TGF-beta signaling pathway
mlx04710
Circadian rhythm
mlx05132
Salmonella infection
mlx05170
Human immunodeficiency virus 1 infection
mlx05200
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:
mlx00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
118016639 (SKP1)
04120 Ubiquitin mediated proteolysis
118016639 (SKP1)
09126 Chromosome
03083 Polycomb repressive complex
118016639 (SKP1)
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
118016639 (SKP1)
04350 TGF-beta signaling pathway
118016639 (SKP1)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
118016639 (SKP1)
04114 Oocyte meiosis
118016639 (SKP1)
09150 Organismal Systems
09159 Environmental adaptation
04710 Circadian rhythm
118016639 (SKP1)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
118016639 (SKP1)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
118016639 (SKP1)
09171 Infectious disease: bacterial
05132 Salmonella infection
118016639 (SKP1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
mlx04131
]
118016639 (SKP1)
04121 Ubiquitin system [BR:
mlx04121
]
118016639 (SKP1)
03036 Chromosome and associated proteins [BR:
mlx03036
]
118016639 (SKP1)
Membrane trafficking [BR:
mlx04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
118016639 (SKP1)
Ubiquitin system [BR:
mlx04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
118016639 (SKP1)
Cul7 complex
118016639 (SKP1)
Chromosome and associated proteins [BR:
mlx03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
118016639 (SKP1)
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
118016639 (SKP1)
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
118016639
NCBI-ProteinID:
XP_034870027
LinkDB
All DBs
Position
Unknown
AA seq
163 aa
AA seq
DB search
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq
492 nt
NT seq
+upstream
nt +downstream
nt
atgccttcaattaagttgcagagttccgatggagagatatttgaggttgatgttgaaatt
gccaaacagtctgtgactatcaagaccatgttggaagatttgggaatggatgatgaggga
gatgatgacccagttcctctcccaaatgttaacgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgacccccctcctcccgaggatgatgagaacaaagaaaag
cggacagatgatatccctgtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttattctggctgcgaactacttagatatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagatccgcaagaccttcaat
atcaaaaatgactttactgaagaagaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga
DBGET
integrated database retrieval system