KEGG   Mirounga leonina (Southern elephant seal): 4355876
Entry
4355876           CDS       T07472                                 
Symbol
ND6
Name
(RefSeq) NADH dehydrogenase subunit 6
  KO
K03884  NADH-ubiquinone oxidoreductase chain 6 [EC:7.1.1.2]
Organism
mlx  Mirounga leonina (Southern elephant seal)
Pathway
mlx00190  Oxidative phosphorylation
mlx01100  Metabolic pathways
mlx04714  Thermogenesis
mlx04723  Retrograde endocannabinoid signaling
mlx05010  Alzheimer disease
mlx05012  Parkinson disease
mlx05014  Amyotrophic lateral sclerosis
mlx05016  Huntington disease
mlx05020  Prion disease
mlx05022  Pathways of neurodegeneration - multiple diseases
mlx05208  Chemical carcinogenesis - reactive oxygen species
mlx05415  Diabetic cardiomyopathy
Module
mlx_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Brite
KEGG Orthology (KO) [BR:mlx00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4355876 (ND6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4355876 (ND6)
  09159 Environmental adaptation
   04714 Thermogenesis
    4355876 (ND6)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    4355876 (ND6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4355876 (ND6)
   05012 Parkinson disease
    4355876 (ND6)
   05014 Amyotrophic lateral sclerosis
    4355876 (ND6)
   05016 Huntington disease
    4355876 (ND6)
   05020 Prion disease
    4355876 (ND6)
   05022 Pathways of neurodegeneration - multiple diseases
    4355876 (ND6)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4355876 (ND6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mlx03029]
    4355876 (ND6)
Enzymes [BR:mlx01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     4355876 (ND6)
Mitochondrial biogenesis [BR:mlx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4355876 (ND6)
SSDB
Motif
Pfam: Oxidored_q3 DUF6600
Other DBs
NCBI-GeneID: 4355876
NCBI-ProteinID: YP_778784
UniProt: Q678T0
LinkDB
Position
MT
AA seq 175 aa
MMTYIVFILSVIFVISFVGFSSKPSPIYGGLVLIVGGAVGCGIVLSFGGSFLGLMVFLIY
LGGMLVVFGYTTAMATEQYPEVWISNKAVLGAFVMGLLSELLLACYILKDDEVDVVFEFN
GMGDWVVYDTGDSGFFSEEAVGVAALYSYGTWLVVVTGWSLFIGVLVIMEVTRGN
NT seq 528 nt   +upstreamnt  +downstreamnt
atgataacgtacattgtatttattttaagtgttatttttgtaattagttttgtggggttt
tcttctaaaccttctcctatttatggtgggcttgttttaattgttggtggggctgttggt
tgtggtattgtattgagttttggagggtcttttttgggtttaatagtttttttaatttat
ttgggaggtatgcttgttgtttttggttatacgactgctatagctactgagcagtatcct
gaggtttgaatttctaataaagctgtactgggtgcttttgttataggtttgttgtcagag
ttattacttgcttgttatattttgaaggatgatgaggttgatgttgtgtttgagtttaat
ggtatgggggattgagtggtttatgatacgggggattcgggattttttagtgaggaggct
gtgggtgttgcggctttatatagctatggcacttgattggttgttgtgactggttggtct
ctttttattggagtactggtgattatggaagttactcgggggaattaa

DBGET integrated database retrieval system