Micrococcus lylae: CJ228_001995 Help Entry CJ228_001995      CDS       T09111                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mly  Micrococcus lylae Pathway mly00190   Oxidative phosphorylation mly01100   Metabolic pathways Module mly_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mly00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CJ228_001995  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mly00194]     CJ228_001995 Photosynthesis proteins [BR:mly00194]  Photosystem and electron transport system   F-type ATPase [OT]    CJ228_001995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Cytochrom_C_asm DUF4233 Motif Other DBs NCBI-ProteinID:  WIK82612 LinkDB All DBs Position 445294..445509 Genome browser AA seq 71 aa AA seqDB search MDLHGSLNMIGYGLASIGSAIGVGLIFAAYINGVARQPEAQRILQPIALLGFALAEALAI LGLVFAFVIGA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggatctccacggttctctcaacatgatcggctacggcctggcctccatcggctccgcc atcggcgtgggcctcatcttcgccgcctacatcaacggcgtcgcccgccagccggaggcc cagcgcatcctgcagccgatcgccctgctcggcttcgcgctggccgaggccctcgccatc ctgggcctggtcttcgccttcgtcatcggcgcctga

DBGET integrated database retrieval system