Microbacterium lushaniae: F6J85_01000 Help Entry F6J85_01000       CDS       T07230                                  Name (GenBank) NrdH-redoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mlz  Microbacterium lushaniae Brite KEGG Orthology (KO) [BR:mlz00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     F6J85_01000 Enzymes [BR:mlz01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      F6J85_01000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Thioredoxin_9 DUF6074 Thioredoxin Motif Other DBs NCBI-ProteinID:  QEW01812 UniProt:  A0A5J6L061 LinkDB All DBs Position complement(226650..226907) Genome browser AA seq 85 aa AA seqDB search MTSSASVTMFGADWCRDCRRTKAQLDELGLPYEYVDLEADPAAADVAREISGRTNIPVVV YPDASHHVEPTNAEVEAKLRELALI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgacttcttctgcctctgtgaccatgttcggcgccgactggtgccgcgattgccgccgc acgaaagcccagctcgacgagctcggcctgccctacgagtacgtcgacctggaggcagac ccggccgccgccgacgtggcgcgggagatctccggccgcacgaacatccccgtcgtggtc taccccgacgcctctcaccacgtcgagccgaccaacgccgaggtggaagccaagctccgc gagctcgcgctcatctga

DBGET integrated database retrieval system