Methanosarcina mazei Go1: MM_0600 Help Entry MM_0600           CDS       T00082                                  Name (GenBank) SSU ribosomal protein S27AE   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mma  Methanosarcina mazei Go1 Pathway mma03010   Ribosome Brite KEGG Orthology (KO) [BR:mma00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MM_0600   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MM_0600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mma03011]     MM_0600    04121 Ubiquitin system [BR:mma04121]     MM_0600   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mma04147]     MM_0600 Ribosome [BR:mma03011]  Ribosomal proteins   Eukaryotes    Small subunit     MM_0600   Archaea     MM_0600 Ubiquitin system [BR:mma04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MM_0600 Exosome [BR:mma04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MM_0600   Exosomal proteins of colorectal cancer cells    MM_0600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_ribbon_RPB9 IBR_1 Zn_Ribbon_TF Cas12f1-like_TNB Zn_ribbon_3 DUF6671 DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AAM30296 UniProt:  Q8PZ94 LinkDB All DBs Position 729156..729305 Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattattacaaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggtgtattccttgccgaccacaaaaaccgcctcgcctgcggg aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system