Methanosarcina mazei Go1: MM_1797 Help Entry MM_1797           CDS       T00082                                  Symbol groES Name (GenBank) 10 kDa chaperonin   KO K04078   chaperonin GroES Organism mma  Methanosarcina mazei Go1 Brite KEGG Orthology (KO) [BR:mma00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mma03110]     MM_1797 (groES)    03029 Mitochondrial biogenesis [BR:mma03029]     MM_1797 (groES) Chaperones and folding catalysts [BR:mma03110]  Heat shock proteins   HSP10    MM_1797 (groES) Mitochondrial biogenesis [BR:mma03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     MM_1797 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  AAM31493 UniProt:  Q8PW07 LinkDB All DBs Position 2145972..2146250 Genome browser AA seq 92 aa AA seqDB search MIVKPIGERVLLKHQKKEEVTKGGIYIPESARQEKKEGIVVAVGTFEDGKELPLKKDDHV IYGGYQADEIEIDDEKYIFVDFKDILATVVEE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgattgtcaaacctattggcgaacgtgtattactcaagcaccagaagaaagaagaagtc actaaaggtgggatctatatccctgaatcagcaaggcaggaaaagaaagaaggaattgtt gtcgctgtggggacatttgaagatgggaaagaacttccccttaagaaggatgaccatgta atttacgggggatatcaggctgatgagattgaaatcgatgatgaaaaatatatttttgtc gatttcaaggatatcctggcaacagttgttgaagaataa

DBGET integrated database retrieval system