Methanosarcina mazei C16: MSMAC_0710 Help Entry MSMAC_0710        CDS       T04626                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mmac  Methanosarcina mazei C16 Pathway mmac03010   Ribosome Brite KEGG Orthology (KO) [BR:mmac00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSMAC_0710   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSMAC_0710  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mmac03011]     MSMAC_0710    04121 Ubiquitin system [BR:mmac04121]     MSMAC_0710   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mmac04147]     MSMAC_0710 Ribosome [BR:mmac03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSMAC_0710   Archaea     MSMAC_0710 Ubiquitin system [BR:mmac04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSMAC_0710 Exosome [BR:mmac04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSMAC_0710   Exosomal proteins of colorectal cancer cells    MSMAC_0710 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_ribbon_RPB9 IBR_1 Zn_Ribbon_TF Cas12f1-like_TNB DUF6671 DUF1451 MqsA_antitoxin Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  AKB70600 UniProt:  A0A0E3WR70 LinkDB All DBs Position complement(858859..859008) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattattacaaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggtgtattccttgccgaccacaaaaaccgcctcgcctgcggg aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system