KEGG   Mycobacterium marinum E11: MMARE11_34770
Entry
MMARE11_34770     CDS       T04774                                 
Name
(GenBank) oxidoreductase
Organism
mmae  Mycobacterium marinum E11
SSDB
Motif
Pfam: adh_short adh_short_C2 Epimerase KR DUF1776 GDP_Man_Dehyd RmlD_sub_bind HHH_5
Other DBs
NCBI-ProteinID: CDM77618
LinkDB
Position
4223504..4224349
AA seq 281 aa
MTSTPPVALITGVSSGIGAAIAVRLASAGFRVVGTSRAPQRLAPIPGVETLALDVTDDTA
VRSVVSEVIDRTGRIDVLVNNAGLGIAGAAEESSIAQARSLFDTNFFGLIRLTNEVLPHM
RRRGSGRIINISSVLGFLPAPYAALYAASKHAVEGYTESLDHELREYGVRALLVEPSYTR
TDFESNMWEADTPQAAYADNRAAVRAVMTDKIRNAELPTVVADATYAAATDKRIKLRYPA
GRHARQLALLKRIAPAAVLDNGIRKQTGLNSPRPTPVPAER
NT seq 846 nt   +upstreamnt  +downstreamnt
atgacatccacaccgcccgtcgcactgatcaccggagtgtcctctggcatcggcgcggcc
attgcagtgcgactggccagcgcgggattccgcgtggtcggcacctcgcgcgcaccgcag
cgcttggctccgattcccggtgtcgagaccttggcactggacgtcaccgacgacaccgcg
gttcgctcggtggtgtcggaggtcatcgaccggaccggacgcatcgacgtgctggtcaac
aacgccggcctgggaatcgccggagccgccgaagaaagctcgatcgcccaagcccgttcc
ttgttcgataccaacttcttcggcctcatccgcctcaccaatgaggtgctgccgcacatg
cgccgacgcggcagcgggcgcatcatcaacatcagctcggtgctcggcttcctccccgcg
ccgtatgcggccctctacgccgcgtcaaagcatgccgtagagggttacaccgaatcgctc
gatcacgaacttcgcgagtacggcgtacgcgcgctgctggtcgaacccagttacacccga
acagatttcgagtcgaacatgtgggaagccgacacaccgcaggcggcctacgccgacaat
cgcgccgccgtgcgcgcagtgatgacagacaagattcgcaacgccgagttgcccaccgtt
gtcgctgacgccacgtacgccgcggccaccgacaaacggatcaaactgcgctaccccgcc
ggtcgccacgcccgacaactcgcgttgctcaagcgcatcgcaccggccgccgtgctcgac
aacggcatccgcaagcaaaccggactgaattcgccgcgaccgacaccggttccagccgag
cgctga

DBGET integrated database retrieval system