Methylophaga marina: GCM100_19540 Help Entry GCM100_19540      CDS       T09183                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mmaf  Methylophaga marina Pathway mmaf01100   Metabolic pathways mmaf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmaf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GCM100_19540    00074 Mycolic acid biosynthesis     GCM100_19540   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GCM100_19540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDZ74235 LinkDB All DBs Position 1901749..1902009 Genome browser AA seq 86 aa AA seqDB search MNALHNEIKLMIINSLDLEDIDVEDIDSDDPLFVDGLGLDSIDALEIGLALQKQYGIKLK SDSEETRQHFASVSALAALVEEHRTK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gtgaacgcactgcataatgaaataaaattaatgattatcaacagcctcgatctggaagat atcgatgttgaggatatcgacagtgacgaccccttatttgtagatggacttggactcgac tcgattgatgcactggagattggtttagcgctacaaaagcaatatggcattaaacttaag tcagactcggaagagacaaggcaacattttgccagtgtgagtgctttagctgctctggtt gaagaacatagaacaaaatag

DBGET integrated database retrieval system