Methylocaldum marinum: sS8_3203 Help Entry sS8_3203          CDS       T05638                                  Name (GenBank) acyl-carrier protein   KO K02078   acyl carrier protein Organism mmai  Methylocaldum marinum Pathway mmai01100   Metabolic pathways mmai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mmai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sS8_3203    00074 Mycolic acid biosynthesis     sS8_3203   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sS8_3203 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BBA35146 UniProt:  A0A250KUC9 LinkDB All DBs Position complement(3533993..3534262) Genome browser AA seq 89 aa AA seqDB search MQNEQIKTELKNIFADRLNMDIAAINAGDDDGLFDPEGWNIDSIDVIDIVLGVEQTFGVK LKQDEEVEAHFRTLNTLADHIGQLVAAKA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaaaacgagcaaatcaagaccgaactgaaaaacatcttcgctgaccgcctgaacatg gatatcgccgcgatcaatgcgggcgacgatgacggattgttcgatccggaaggatggaac atcgactccatcgacgtgatcgacatcgtgctcggcgtggaacagaccttcggcgtgaag ctgaaacaggacgaggaggtggaagcccacttccggactctcaacaccttggccgaccac atcggtcagctggtggccgcgaaggcctga

DBGET integrated database retrieval system