Methylocaldum marinum: sS8_3340 Help Entry sS8_3340          CDS       T05638                                  Name (GenBank) uncharacterized protein   KO K09892   cell division protein ZapB Organism mmai  Methylocaldum marinum Brite KEGG Orthology (KO) [BR:mmai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmai03036]     sS8_3340 Chromosome and associated proteins [BR:mmai03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     sS8_3340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF2205 NRBF2 bZIP_1 DUF4472 GAS DivIC Spc24 TSC22 MCM_WH_arc UPF0150 Motif Other DBs NCBI-ProteinID:  BBA35278 UniProt:  A0A250KUE0 LinkDB All DBs Position complement(3672230..3672454) Genome browser AA seq 74 aa AA seqDB search MIADMFDLDAELARLENRIDILVATCERLRGENRVLKSTIEEWMQERVQLSDKTEMAKSR VEAMISRLKSMGHE NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgatagccgatatgtttgatttggatgccgagttagcacgtttggaaaatagaatcgac atactggttgccacgtgcgaacggctgcgaggcgagaatcgggtgctgaagtccacaatt gaggaatggatgcaagagcgggtgcaactgtccgataaaaccgagatggcgaaaagccgc gtcgaagcgatgatttcccgcctgaaatccatgggacacgaatga

DBGET integrated database retrieval system