Methylocaldum marinum: sS8_4637 Help Entry sS8_4637          CDS       T05638                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism mmai  Methylocaldum marinum Brite KEGG Orthology (KO) [BR:mmai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mmai03036]     sS8_4637 Chromosome and associated proteins [BR:mmai03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     sS8_4637 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  BBA36567 UniProt:  A0A250KY76 LinkDB All DBs Position 5021782..5022039 Genome browser AA seq 85 aa AA seqDB search MRFLLMLLAVALASALGVVYTKYRSRMLFAEVQRLEQELNAYDEEWGRLQLEQNTWAEHS RIERLAHGRLGMLLPARESIIYIKP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagatttttgctgatgctgctggcggtggccttggcctctgctctgggcgttgtgtat acgaagtatagatcgcggatgctgttcgccgaagttcaacgcctcgaacaggagctcaat gcctatgacgaagaatgggggcggctgcaactcgagcaaaatacctgggccgagcatagc cgcatcgaaaggctggcgcatggccgtttgggcatgttgttgcctgccagggaatcaatc atttatataaaaccttag

DBGET integrated database retrieval system